Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UVK6

Protein Details
Accession A0A1Y1UVK6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
74-94IKSPPRRVRVRLDRKRNDDEGBasic
NLS Segment(s)
PositionSequence
75-88KSPPRRVRVRLDRK
Subcellular Location(s) nucl 12, cyto_nucl 12, cyto 10, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000054  Ribosomal_L31e  
IPR020052  Ribosomal_L31e_CS  
IPR023621  Ribosomal_L31e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01198  Ribosomal_L31e  
PROSITE View protein in PROSITE  
PS01144  RIBOSOMAL_L31E  
CDD cd00463  Ribosomal_L31e  
Amino Acid Sequences MAPTKKERKTRSALHDVVTREYTVHLHKRVHGTAFKRRAPKAIKAITEFAQKSMGVKDVRISPGLNQAIWSRGIKSPPRRVRVRLDRKRNDDEGAKEKLYVLASVVEGVTNFKGLETVVVEAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.65
3 0.58
4 0.53
5 0.45
6 0.36
7 0.26
8 0.24
9 0.23
10 0.24
11 0.29
12 0.3
13 0.31
14 0.35
15 0.41
16 0.43
17 0.45
18 0.44
19 0.43
20 0.48
21 0.54
22 0.55
23 0.56
24 0.54
25 0.58
26 0.56
27 0.58
28 0.58
29 0.55
30 0.53
31 0.49
32 0.51
33 0.45
34 0.46
35 0.39
36 0.3
37 0.25
38 0.22
39 0.19
40 0.17
41 0.2
42 0.13
43 0.13
44 0.14
45 0.16
46 0.17
47 0.17
48 0.17
49 0.13
50 0.2
51 0.2
52 0.18
53 0.16
54 0.15
55 0.16
56 0.17
57 0.17
58 0.12
59 0.13
60 0.18
61 0.24
62 0.33
63 0.42
64 0.49
65 0.56
66 0.58
67 0.61
68 0.67
69 0.71
70 0.74
71 0.74
72 0.77
73 0.79
74 0.81
75 0.83
76 0.76
77 0.69
78 0.63
79 0.59
80 0.54
81 0.5
82 0.43
83 0.36
84 0.33
85 0.32
86 0.27
87 0.2
88 0.15
89 0.11
90 0.11
91 0.11
92 0.11
93 0.08
94 0.08
95 0.1
96 0.09
97 0.08
98 0.08
99 0.08
100 0.08
101 0.08
102 0.1
103 0.09
104 0.1