Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1USW5

Protein Details
Accession A0A1Y1USW5    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
193-220QPPRLVPLEQKPGKRKKRSGLAKLLAENHydrophilic
NLS Segment(s)
PositionSequence
203-213KPGKRKKRSGL
Subcellular Location(s) nucl 16, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MSVATAAPGPRIGPIDPHTQRFMLSLPPLMHSISPTLAAVHLARARLWLSISTAGQLSEGWCHSCGGLRQGYGGTSKKRRKHDQIVPVGHGVEAELSTTGKRKTPNCMICGAPFRRAQPNLASQRRFPSARIARRKQALDAANIASQSGPSMPLPRVMPFKPKPSSSPPPHLLAQPTTSHILFDPPTPPTYPQPPRLVPLEQKPGKRKKRSGLAKLLAENKERNESNQSGGSWGLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.31
3 0.34
4 0.38
5 0.39
6 0.37
7 0.37
8 0.33
9 0.3
10 0.25
11 0.23
12 0.25
13 0.22
14 0.24
15 0.24
16 0.24
17 0.23
18 0.18
19 0.18
20 0.14
21 0.14
22 0.12
23 0.11
24 0.1
25 0.12
26 0.11
27 0.13
28 0.15
29 0.14
30 0.14
31 0.15
32 0.16
33 0.15
34 0.16
35 0.12
36 0.13
37 0.15
38 0.15
39 0.15
40 0.14
41 0.13
42 0.13
43 0.12
44 0.1
45 0.09
46 0.1
47 0.1
48 0.11
49 0.11
50 0.11
51 0.13
52 0.14
53 0.16
54 0.17
55 0.16
56 0.16
57 0.16
58 0.17
59 0.19
60 0.22
61 0.24
62 0.32
63 0.4
64 0.47
65 0.55
66 0.64
67 0.69
68 0.75
69 0.77
70 0.77
71 0.79
72 0.76
73 0.7
74 0.61
75 0.52
76 0.41
77 0.32
78 0.21
79 0.11
80 0.07
81 0.05
82 0.04
83 0.04
84 0.05
85 0.08
86 0.08
87 0.11
88 0.16
89 0.17
90 0.24
91 0.34
92 0.39
93 0.38
94 0.4
95 0.38
96 0.37
97 0.42
98 0.37
99 0.31
100 0.28
101 0.28
102 0.32
103 0.32
104 0.31
105 0.26
106 0.34
107 0.39
108 0.43
109 0.42
110 0.38
111 0.4
112 0.43
113 0.4
114 0.32
115 0.33
116 0.36
117 0.44
118 0.52
119 0.54
120 0.55
121 0.6
122 0.6
123 0.51
124 0.49
125 0.42
126 0.34
127 0.32
128 0.28
129 0.23
130 0.22
131 0.21
132 0.13
133 0.11
134 0.09
135 0.06
136 0.06
137 0.06
138 0.08
139 0.09
140 0.12
141 0.14
142 0.16
143 0.21
144 0.21
145 0.3
146 0.31
147 0.39
148 0.41
149 0.42
150 0.44
151 0.48
152 0.57
153 0.55
154 0.6
155 0.55
156 0.55
157 0.54
158 0.52
159 0.46
160 0.38
161 0.34
162 0.27
163 0.26
164 0.25
165 0.23
166 0.21
167 0.18
168 0.19
169 0.16
170 0.17
171 0.17
172 0.16
173 0.18
174 0.19
175 0.22
176 0.24
177 0.33
178 0.38
179 0.43
180 0.48
181 0.48
182 0.5
183 0.51
184 0.52
185 0.48
186 0.5
187 0.53
188 0.51
189 0.58
190 0.64
191 0.71
192 0.76
193 0.8
194 0.8
195 0.8
196 0.85
197 0.87
198 0.87
199 0.87
200 0.85
201 0.81
202 0.79
203 0.77
204 0.7
205 0.64
206 0.58
207 0.51
208 0.52
209 0.46
210 0.44
211 0.43
212 0.41
213 0.41
214 0.41
215 0.38
216 0.31