Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UQZ4

Protein Details
Accession A0A1Y1UQZ4    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-36RYTISRKWGVRRDIKRRELFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, cyto_mito 10.5, nucl 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001209  Ribosomal_S14  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00253  Ribosomal_S14  
Amino Acid Sequences MSFTNKVTNQVMHNNLRYTISRKWGVRRDIKRRELFAQSEAERQAYLFIARNTTLPAQIRYKAQLSLNALTDTHASSTEISNRCVETGRGRGVLGRYGLCRIAFRLRALSGDLPGVTKATW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.41
4 0.39
5 0.37
6 0.35
7 0.35
8 0.38
9 0.41
10 0.48
11 0.54
12 0.6
13 0.65
14 0.7
15 0.73
16 0.77
17 0.82
18 0.79
19 0.76
20 0.71
21 0.68
22 0.6
23 0.52
24 0.48
25 0.39
26 0.37
27 0.33
28 0.28
29 0.22
30 0.19
31 0.17
32 0.11
33 0.11
34 0.11
35 0.1
36 0.11
37 0.12
38 0.12
39 0.13
40 0.13
41 0.15
42 0.13
43 0.16
44 0.17
45 0.18
46 0.19
47 0.19
48 0.2
49 0.2
50 0.19
51 0.2
52 0.21
53 0.21
54 0.21
55 0.19
56 0.18
57 0.16
58 0.16
59 0.13
60 0.09
61 0.08
62 0.07
63 0.08
64 0.09
65 0.16
66 0.17
67 0.18
68 0.19
69 0.19
70 0.19
71 0.19
72 0.2
73 0.18
74 0.21
75 0.23
76 0.22
77 0.22
78 0.24
79 0.24
80 0.26
81 0.23
82 0.2
83 0.18
84 0.19
85 0.21
86 0.19
87 0.19
88 0.19
89 0.25
90 0.26
91 0.27
92 0.29
93 0.28
94 0.29
95 0.32
96 0.3
97 0.23
98 0.22
99 0.21
100 0.17
101 0.17