Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UD25

Protein Details
Accession A0A1Y1UD25    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-33KSPPVTRRTYCKAKACRKHTPHKVTQYKKGKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MKSPPVTRRTYCKAKACRKHTPHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTQCKSKHQLSLKRCKHFELGGDKKQRGAAISF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.83
3 0.83
4 0.85
5 0.84
6 0.86
7 0.87
8 0.86
9 0.85
10 0.85
11 0.88
12 0.83
13 0.85
14 0.85
15 0.8
16 0.75
17 0.7
18 0.6
19 0.54
20 0.51
21 0.51
22 0.5
23 0.49
24 0.49
25 0.49
26 0.53
27 0.55
28 0.57
29 0.52
30 0.52
31 0.57
32 0.58
33 0.61
34 0.59
35 0.58
36 0.57
37 0.59
38 0.5
39 0.45
40 0.41
41 0.33
42 0.35
43 0.37
44 0.35
45 0.3
46 0.37
47 0.41
48 0.5
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.63
58 0.63
59 0.65
60 0.62
61 0.57
62 0.56
63 0.51
64 0.5
65 0.52
66 0.5
67 0.5
68 0.55
69 0.6
70 0.63
71 0.73
72 0.76
73 0.77
74 0.74
75 0.69
76 0.64
77 0.58
78 0.55
79 0.55
80 0.55
81 0.55
82 0.62
83 0.59
84 0.57
85 0.56
86 0.5