Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UIJ3

Protein Details
Accession A0A1Y1UIJ3    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
17-43ADTVSSHRKKKKWSKGKVKDKANNAVVHydrophilic
NLS Segment(s)
PositionSequence
23-36HRKKKKWSKGKVKD
Subcellular Location(s) cyto 14, nucl 8, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MRMGSWNCEIMVSCAGADTVSSHRKKKKWSKGKVKDKANNAVVLDKTLFDRINKEVPTFRVITVSTLIDRLKVNGSLARKAIAHLEKEGQIKRVTHHNAQLIYTRAIAGKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.09
5 0.08
6 0.12
7 0.2
8 0.25
9 0.32
10 0.4
11 0.45
12 0.56
13 0.65
14 0.7
15 0.73
16 0.8
17 0.84
18 0.87
19 0.94
20 0.93
21 0.92
22 0.88
23 0.84
24 0.82
25 0.73
26 0.65
27 0.54
28 0.48
29 0.37
30 0.31
31 0.24
32 0.16
33 0.14
34 0.13
35 0.13
36 0.1
37 0.13
38 0.14
39 0.19
40 0.19
41 0.2
42 0.2
43 0.21
44 0.23
45 0.22
46 0.19
47 0.16
48 0.15
49 0.15
50 0.14
51 0.14
52 0.11
53 0.12
54 0.12
55 0.11
56 0.11
57 0.11
58 0.12
59 0.12
60 0.12
61 0.14
62 0.17
63 0.18
64 0.19
65 0.19
66 0.17
67 0.17
68 0.23
69 0.23
70 0.23
71 0.22
72 0.24
73 0.27
74 0.33
75 0.34
76 0.3
77 0.3
78 0.3
79 0.3
80 0.37
81 0.39
82 0.39
83 0.44
84 0.47
85 0.45
86 0.46
87 0.48
88 0.42
89 0.37
90 0.32
91 0.26