Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UQH8

Protein Details
Accession A0A1Y1UQH8    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
391-410GEVGGKKDKKHNLHWRYEDPBasic
NLS Segment(s)
PositionSequence
132-136KKRKR
Subcellular Location(s) nucl 10.5, cyto_nucl 10.5, cyto 9.5, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR024738  Hfi1/Tada1  
Gene Ontology GO:0005634  C:nucleus  
GO:0070461  C:SAGA-type complex  
Pfam View protein in Pfam  
PF12767  SAGA-Tad1  
Amino Acid Sequences MSDSGPESRDEASNAVVESGHHVSPRQNGMMTHQPEAGPSRPPPPPLPPMVEKLFATDIQLIKQELHDALGEAGLAYWKTLNGYLLGQIGKSELEVMVRGWLKGSKVQLHNQFMMALLYHAGIPHAPSSGGKKRKRVGPEDPDYDVNEYIIEPKARVQQWMQGIGGRERARIRRAVIGRQGQDEDTAGEADPSSNKNWGIQAGNTMPPLAVSAKQLPASHQLSHRLSQLAKAYDLNLAPDALSAIGEFMAVELDAHLSDILHAYVHLAARDRIGSDTLHVPPGLNPDLDLDVKVEDGGMTKPDLDRLRDLFTLNPGLHPSTSPALYKLASSLSQAEAEYNSSPLKLERKPSLTPEIDVTPQVNGDRAGPMMKKLVNDGLVKVDNVKKGEDGEVGGKKDKKHNLHWRYEDPALILKDVFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.14
4 0.13
5 0.16
6 0.18
7 0.18
8 0.17
9 0.18
10 0.21
11 0.28
12 0.33
13 0.31
14 0.3
15 0.29
16 0.35
17 0.43
18 0.43
19 0.38
20 0.35
21 0.32
22 0.32
23 0.37
24 0.32
25 0.28
26 0.27
27 0.31
28 0.33
29 0.37
30 0.39
31 0.42
32 0.46
33 0.46
34 0.51
35 0.48
36 0.51
37 0.5
38 0.49
39 0.41
40 0.38
41 0.36
42 0.29
43 0.27
44 0.26
45 0.23
46 0.21
47 0.24
48 0.21
49 0.19
50 0.19
51 0.19
52 0.15
53 0.15
54 0.14
55 0.12
56 0.11
57 0.1
58 0.1
59 0.07
60 0.06
61 0.06
62 0.06
63 0.05
64 0.06
65 0.06
66 0.07
67 0.08
68 0.09
69 0.09
70 0.1
71 0.11
72 0.14
73 0.14
74 0.12
75 0.11
76 0.11
77 0.1
78 0.09
79 0.09
80 0.06
81 0.06
82 0.07
83 0.07
84 0.12
85 0.13
86 0.13
87 0.13
88 0.15
89 0.16
90 0.19
91 0.24
92 0.26
93 0.3
94 0.38
95 0.45
96 0.48
97 0.48
98 0.45
99 0.4
100 0.32
101 0.28
102 0.2
103 0.12
104 0.07
105 0.06
106 0.06
107 0.06
108 0.06
109 0.05
110 0.06
111 0.06
112 0.06
113 0.06
114 0.07
115 0.15
116 0.24
117 0.34
118 0.38
119 0.45
120 0.51
121 0.57
122 0.64
123 0.64
124 0.66
125 0.66
126 0.69
127 0.65
128 0.62
129 0.57
130 0.51
131 0.45
132 0.34
133 0.24
134 0.17
135 0.12
136 0.11
137 0.12
138 0.11
139 0.09
140 0.12
141 0.19
142 0.19
143 0.21
144 0.2
145 0.24
146 0.27
147 0.29
148 0.26
149 0.22
150 0.23
151 0.22
152 0.27
153 0.22
154 0.22
155 0.23
156 0.27
157 0.28
158 0.29
159 0.3
160 0.31
161 0.34
162 0.37
163 0.4
164 0.43
165 0.42
166 0.4
167 0.4
168 0.32
169 0.29
170 0.23
171 0.16
172 0.1
173 0.09
174 0.07
175 0.06
176 0.06
177 0.05
178 0.07
179 0.08
180 0.08
181 0.09
182 0.09
183 0.1
184 0.11
185 0.13
186 0.13
187 0.12
188 0.14
189 0.14
190 0.15
191 0.14
192 0.14
193 0.11
194 0.1
195 0.11
196 0.08
197 0.07
198 0.08
199 0.1
200 0.11
201 0.14
202 0.14
203 0.14
204 0.2
205 0.22
206 0.22
207 0.22
208 0.28
209 0.28
210 0.29
211 0.3
212 0.25
213 0.23
214 0.24
215 0.26
216 0.2
217 0.19
218 0.18
219 0.17
220 0.17
221 0.17
222 0.15
223 0.11
224 0.09
225 0.08
226 0.08
227 0.07
228 0.05
229 0.04
230 0.03
231 0.03
232 0.03
233 0.03
234 0.03
235 0.03
236 0.03
237 0.03
238 0.03
239 0.03
240 0.03
241 0.03
242 0.03
243 0.03
244 0.03
245 0.04
246 0.04
247 0.04
248 0.04
249 0.04
250 0.04
251 0.06
252 0.07
253 0.07
254 0.08
255 0.09
256 0.1
257 0.1
258 0.1
259 0.1
260 0.1
261 0.1
262 0.1
263 0.14
264 0.14
265 0.15
266 0.15
267 0.14
268 0.14
269 0.19
270 0.19
271 0.14
272 0.13
273 0.14
274 0.16
275 0.16
276 0.15
277 0.1
278 0.09
279 0.09
280 0.09
281 0.07
282 0.05
283 0.06
284 0.06
285 0.07
286 0.07
287 0.08
288 0.08
289 0.14
290 0.17
291 0.19
292 0.22
293 0.24
294 0.28
295 0.28
296 0.29
297 0.24
298 0.25
299 0.27
300 0.23
301 0.22
302 0.19
303 0.2
304 0.19
305 0.18
306 0.18
307 0.16
308 0.18
309 0.17
310 0.17
311 0.17
312 0.17
313 0.17
314 0.15
315 0.14
316 0.13
317 0.14
318 0.15
319 0.14
320 0.15
321 0.15
322 0.14
323 0.13
324 0.15
325 0.14
326 0.13
327 0.12
328 0.11
329 0.12
330 0.14
331 0.21
332 0.23
333 0.29
334 0.35
335 0.4
336 0.44
337 0.49
338 0.54
339 0.49
340 0.47
341 0.44
342 0.39
343 0.35
344 0.33
345 0.28
346 0.2
347 0.2
348 0.19
349 0.16
350 0.13
351 0.13
352 0.13
353 0.13
354 0.17
355 0.16
356 0.18
357 0.22
358 0.23
359 0.23
360 0.25
361 0.28
362 0.29
363 0.3
364 0.29
365 0.3
366 0.29
367 0.29
368 0.31
369 0.32
370 0.31
371 0.31
372 0.31
373 0.27
374 0.27
375 0.3
376 0.26
377 0.23
378 0.26
379 0.3
380 0.32
381 0.37
382 0.39
383 0.41
384 0.49
385 0.55
386 0.56
387 0.61
388 0.69
389 0.72
390 0.79
391 0.83
392 0.79
393 0.77
394 0.72
395 0.62
396 0.54
397 0.51
398 0.42
399 0.35