Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UNW1

Protein Details
Accession A0A1Y1UNW1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
152-173EAGKYRFPRHRLRKTMKDETKIBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 12.5, cyto 7, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004821  Cyt_trans-like  
IPR005248  NadD/NMNAT  
IPR045094  NMNAT_euk  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0005524  F:ATP binding  
GO:0000309  F:nicotinamide-nucleotide adenylyltransferase activity  
GO:0004515  F:nicotinate-nucleotide adenylyltransferase activity  
GO:0009435  P:NAD biosynthetic process  
Pfam View protein in Pfam  
PF01467  CTP_transf_like  
CDD cd09286  NMNAT_Eukarya  
Amino Acid Sequences MTGAHSRIPTDPSDEALSTSRSRRLMSGYIFGNPPSPDNTTRHAMYSNLVNERHPTPPLRDLQGRDSPPLSEFTAPSSPTTAGEGMDSAAAAASLAKLKMSTEAPGGGDDGLPRTDTYDPLTGLNDGEADLDESAPQAAFTTAEYMKGEDTEAGKYRFPRHRLRKTMKDETKIPLVIVACGSFSPPTYLHLRMFEMAKDEIVESQTFEIMGGYYSPVSSKYKKAGLAAAQDRVRMCELAVEHTSTWLMVDPWEAGQPEYQRTAVVLEHFDEELNARSGGVTMSDGKKRRYKVMLLAGGDLIESFGEPGVWSEPDLHIILGRFGCLIVERAGSDVWAFLLSHDILYSHRRNVIVIKQLIYNDISSTKVRLFVRRGMSIKYLLPNSVIQYIYDNQLYRGSDARLIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.26
4 0.28
5 0.26
6 0.3
7 0.32
8 0.31
9 0.32
10 0.32
11 0.35
12 0.38
13 0.38
14 0.4
15 0.36
16 0.37
17 0.37
18 0.35
19 0.33
20 0.27
21 0.25
22 0.23
23 0.26
24 0.27
25 0.3
26 0.34
27 0.36
28 0.36
29 0.36
30 0.34
31 0.3
32 0.28
33 0.31
34 0.32
35 0.32
36 0.32
37 0.31
38 0.33
39 0.35
40 0.36
41 0.32
42 0.3
43 0.3
44 0.36
45 0.4
46 0.43
47 0.46
48 0.47
49 0.51
50 0.56
51 0.53
52 0.49
53 0.44
54 0.39
55 0.34
56 0.33
57 0.28
58 0.22
59 0.2
60 0.21
61 0.25
62 0.24
63 0.24
64 0.23
65 0.22
66 0.2
67 0.22
68 0.18
69 0.13
70 0.13
71 0.12
72 0.1
73 0.09
74 0.08
75 0.05
76 0.05
77 0.04
78 0.04
79 0.03
80 0.04
81 0.05
82 0.06
83 0.06
84 0.06
85 0.07
86 0.1
87 0.11
88 0.12
89 0.12
90 0.13
91 0.14
92 0.14
93 0.14
94 0.11
95 0.11
96 0.1
97 0.1
98 0.09
99 0.09
100 0.08
101 0.1
102 0.11
103 0.11
104 0.14
105 0.16
106 0.16
107 0.16
108 0.17
109 0.15
110 0.15
111 0.14
112 0.1
113 0.07
114 0.07
115 0.06
116 0.06
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.04
124 0.04
125 0.04
126 0.04
127 0.05
128 0.09
129 0.09
130 0.1
131 0.11
132 0.11
133 0.11
134 0.11
135 0.11
136 0.09
137 0.1
138 0.12
139 0.15
140 0.16
141 0.18
142 0.2
143 0.28
144 0.34
145 0.38
146 0.46
147 0.53
148 0.62
149 0.71
150 0.77
151 0.79
152 0.81
153 0.86
154 0.82
155 0.76
156 0.7
157 0.62
158 0.58
159 0.48
160 0.39
161 0.31
162 0.24
163 0.19
164 0.16
165 0.12
166 0.08
167 0.07
168 0.08
169 0.05
170 0.05
171 0.07
172 0.07
173 0.09
174 0.12
175 0.15
176 0.16
177 0.17
178 0.18
179 0.17
180 0.17
181 0.15
182 0.15
183 0.12
184 0.11
185 0.1
186 0.09
187 0.08
188 0.09
189 0.09
190 0.06
191 0.06
192 0.06
193 0.06
194 0.06
195 0.05
196 0.04
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.04
203 0.06
204 0.1
205 0.12
206 0.15
207 0.18
208 0.22
209 0.24
210 0.25
211 0.26
212 0.26
213 0.31
214 0.31
215 0.33
216 0.3
217 0.3
218 0.29
219 0.27
220 0.24
221 0.16
222 0.14
223 0.11
224 0.11
225 0.13
226 0.14
227 0.14
228 0.13
229 0.13
230 0.13
231 0.1
232 0.1
233 0.07
234 0.06
235 0.05
236 0.06
237 0.06
238 0.06
239 0.08
240 0.08
241 0.08
242 0.1
243 0.12
244 0.13
245 0.15
246 0.14
247 0.13
248 0.13
249 0.14
250 0.12
251 0.12
252 0.11
253 0.1
254 0.12
255 0.12
256 0.11
257 0.1
258 0.1
259 0.1
260 0.11
261 0.1
262 0.08
263 0.08
264 0.08
265 0.08
266 0.08
267 0.07
268 0.1
269 0.14
270 0.2
271 0.24
272 0.29
273 0.35
274 0.37
275 0.43
276 0.45
277 0.45
278 0.48
279 0.54
280 0.55
281 0.5
282 0.48
283 0.41
284 0.35
285 0.3
286 0.22
287 0.12
288 0.06
289 0.04
290 0.03
291 0.03
292 0.03
293 0.04
294 0.05
295 0.07
296 0.07
297 0.07
298 0.09
299 0.1
300 0.12
301 0.13
302 0.12
303 0.12
304 0.12
305 0.14
306 0.12
307 0.12
308 0.1
309 0.09
310 0.09
311 0.09
312 0.1
313 0.08
314 0.09
315 0.09
316 0.1
317 0.1
318 0.1
319 0.1
320 0.08
321 0.07
322 0.07
323 0.07
324 0.06
325 0.09
326 0.09
327 0.09
328 0.09
329 0.09
330 0.11
331 0.18
332 0.22
333 0.22
334 0.25
335 0.26
336 0.27
337 0.32
338 0.38
339 0.4
340 0.39
341 0.38
342 0.37
343 0.37
344 0.38
345 0.34
346 0.27
347 0.19
348 0.18
349 0.19
350 0.17
351 0.19
352 0.18
353 0.23
354 0.26
355 0.32
356 0.35
357 0.4
358 0.46
359 0.51
360 0.52
361 0.5
362 0.51
363 0.47
364 0.46
365 0.45
366 0.41
367 0.34
368 0.34
369 0.32
370 0.31
371 0.32
372 0.28
373 0.21
374 0.24
375 0.25
376 0.26
377 0.28
378 0.25
379 0.22
380 0.27
381 0.28
382 0.26
383 0.27
384 0.26