Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UM30

Protein Details
Accession A0A1Y1UM30    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
30-51FLPPSIPRKTRRSQRGFPLFIVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10, nucl 9.5, mito 9, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044538  Vta1-like  
IPR039431  Vta1/CALS_N  
IPR023175  Vta1/CALS_N_sf  
IPR041212  Vta1_C  
Gene Ontology GO:0010008  C:endosome membrane  
GO:0032511  P:late endosome to vacuole transport via multivesicular body sorting pathway  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF04652  Vta1  
PF18097  Vta1_C  
Amino Acid Sequences MTPIKRPLSIPTPPSSPEPGRPGSKSFNGFLPPSIPRKTRRSQRGFPLFIVMDNINLPSESVPPELRVGCEQILKRAKELKKAEPIVAYWCCFSAAQKALKIPNRSAEGTKFLLNLLDCLEEMKALLDSNDAIITEAAGAAYVENFALKVFMSADNDDRNGVTGKATIRKFVVAGQFIEVLRCFENGMTEEMEQKLQYARWKAADGAKALREGREPASGPPIPDLDMNPLPSIPSGSPESGPSTVKDSPPLVAAPDSSLAPSTTHPRDSPSESRPKLPDIDTGSNNLRTPRRDHSSGSGAWSTVATPGLAEENEHEKMFPAASAPPPGLASPPRSPATGERKNVRFMGPDGAPLSPAQTYFSVDSVAHPTAPPPTTIEDSPSLPSVNLPPATSRPRGDSGASNNSIPRSMAPIDGARGNGQNGNASVKRASPKHSPHLNPIDTPPPPPPSLASISPTAPQPAVSHNNGPSGGSGGGLGLAPGPPASSAPVSLTRKQVDQVQKHAKWAISALDYDDYETAKEQLKKALAMLGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.47
4 0.47
5 0.48
6 0.5
7 0.52
8 0.53
9 0.54
10 0.53
11 0.56
12 0.53
13 0.48
14 0.47
15 0.45
16 0.43
17 0.38
18 0.36
19 0.35
20 0.37
21 0.42
22 0.43
23 0.45
24 0.53
25 0.62
26 0.67
27 0.73
28 0.76
29 0.77
30 0.83
31 0.86
32 0.82
33 0.73
34 0.69
35 0.59
36 0.49
37 0.44
38 0.33
39 0.24
40 0.2
41 0.2
42 0.13
43 0.12
44 0.12
45 0.09
46 0.11
47 0.12
48 0.15
49 0.15
50 0.16
51 0.2
52 0.21
53 0.22
54 0.22
55 0.23
56 0.22
57 0.27
58 0.27
59 0.32
60 0.4
61 0.39
62 0.41
63 0.47
64 0.49
65 0.53
66 0.58
67 0.57
68 0.59
69 0.62
70 0.6
71 0.53
72 0.5
73 0.47
74 0.44
75 0.37
76 0.27
77 0.24
78 0.22
79 0.2
80 0.2
81 0.21
82 0.24
83 0.27
84 0.29
85 0.33
86 0.4
87 0.47
88 0.5
89 0.45
90 0.45
91 0.46
92 0.46
93 0.45
94 0.4
95 0.38
96 0.36
97 0.35
98 0.28
99 0.23
100 0.23
101 0.2
102 0.17
103 0.13
104 0.12
105 0.1
106 0.11
107 0.1
108 0.08
109 0.08
110 0.07
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.07
117 0.07
118 0.06
119 0.06
120 0.06
121 0.06
122 0.05
123 0.05
124 0.04
125 0.04
126 0.04
127 0.03
128 0.03
129 0.04
130 0.03
131 0.03
132 0.04
133 0.03
134 0.04
135 0.04
136 0.04
137 0.06
138 0.08
139 0.1
140 0.12
141 0.15
142 0.16
143 0.17
144 0.17
145 0.15
146 0.15
147 0.13
148 0.12
149 0.1
150 0.11
151 0.14
152 0.21
153 0.21
154 0.22
155 0.22
156 0.22
157 0.22
158 0.23
159 0.25
160 0.2
161 0.2
162 0.2
163 0.21
164 0.2
165 0.21
166 0.17
167 0.13
168 0.11
169 0.11
170 0.1
171 0.07
172 0.09
173 0.1
174 0.11
175 0.11
176 0.11
177 0.13
178 0.13
179 0.14
180 0.12
181 0.11
182 0.11
183 0.11
184 0.16
185 0.17
186 0.19
187 0.2
188 0.21
189 0.23
190 0.26
191 0.28
192 0.25
193 0.25
194 0.24
195 0.26
196 0.25
197 0.24
198 0.2
199 0.19
200 0.19
201 0.19
202 0.19
203 0.16
204 0.23
205 0.23
206 0.22
207 0.21
208 0.19
209 0.16
210 0.16
211 0.16
212 0.14
213 0.15
214 0.15
215 0.14
216 0.14
217 0.13
218 0.12
219 0.13
220 0.08
221 0.09
222 0.1
223 0.11
224 0.12
225 0.12
226 0.15
227 0.15
228 0.16
229 0.14
230 0.16
231 0.18
232 0.18
233 0.19
234 0.17
235 0.16
236 0.16
237 0.16
238 0.11
239 0.1
240 0.09
241 0.08
242 0.08
243 0.07
244 0.06
245 0.07
246 0.06
247 0.07
248 0.08
249 0.13
250 0.14
251 0.15
252 0.15
253 0.18
254 0.21
255 0.26
256 0.3
257 0.31
258 0.39
259 0.39
260 0.43
261 0.41
262 0.41
263 0.38
264 0.33
265 0.32
266 0.29
267 0.32
268 0.28
269 0.3
270 0.3
271 0.29
272 0.29
273 0.28
274 0.24
275 0.22
276 0.25
277 0.29
278 0.33
279 0.34
280 0.35
281 0.36
282 0.38
283 0.36
284 0.35
285 0.29
286 0.22
287 0.2
288 0.18
289 0.13
290 0.09
291 0.09
292 0.05
293 0.05
294 0.05
295 0.06
296 0.06
297 0.06
298 0.07
299 0.1
300 0.12
301 0.12
302 0.11
303 0.11
304 0.12
305 0.11
306 0.1
307 0.07
308 0.08
309 0.09
310 0.1
311 0.1
312 0.1
313 0.1
314 0.11
315 0.11
316 0.12
317 0.16
318 0.17
319 0.22
320 0.22
321 0.22
322 0.24
323 0.3
324 0.38
325 0.41
326 0.43
327 0.46
328 0.48
329 0.51
330 0.51
331 0.44
332 0.36
333 0.3
334 0.31
335 0.23
336 0.23
337 0.21
338 0.19
339 0.18
340 0.16
341 0.15
342 0.1
343 0.1
344 0.1
345 0.09
346 0.11
347 0.11
348 0.12
349 0.12
350 0.11
351 0.13
352 0.15
353 0.15
354 0.13
355 0.12
356 0.13
357 0.16
358 0.17
359 0.16
360 0.13
361 0.16
362 0.19
363 0.19
364 0.22
365 0.2
366 0.21
367 0.21
368 0.21
369 0.18
370 0.14
371 0.15
372 0.14
373 0.17
374 0.17
375 0.16
376 0.17
377 0.22
378 0.28
379 0.31
380 0.3
381 0.3
382 0.32
383 0.34
384 0.34
385 0.33
386 0.35
387 0.4
388 0.4
389 0.36
390 0.34
391 0.33
392 0.31
393 0.26
394 0.2
395 0.16
396 0.16
397 0.15
398 0.16
399 0.17
400 0.18
401 0.19
402 0.2
403 0.17
404 0.17
405 0.18
406 0.17
407 0.16
408 0.16
409 0.16
410 0.21
411 0.2
412 0.21
413 0.2
414 0.22
415 0.28
416 0.29
417 0.33
418 0.37
419 0.44
420 0.52
421 0.6
422 0.6
423 0.63
424 0.7
425 0.67
426 0.6
427 0.57
428 0.54
429 0.46
430 0.45
431 0.4
432 0.36
433 0.34
434 0.32
435 0.3
436 0.28
437 0.31
438 0.31
439 0.29
440 0.26
441 0.27
442 0.28
443 0.27
444 0.24
445 0.2
446 0.18
447 0.17
448 0.22
449 0.27
450 0.29
451 0.33
452 0.33
453 0.36
454 0.35
455 0.34
456 0.27
457 0.24
458 0.2
459 0.14
460 0.12
461 0.08
462 0.08
463 0.08
464 0.07
465 0.05
466 0.05
467 0.05
468 0.05
469 0.05
470 0.05
471 0.06
472 0.09
473 0.1
474 0.1
475 0.14
476 0.23
477 0.28
478 0.32
479 0.39
480 0.38
481 0.4
482 0.41
483 0.47
484 0.48
485 0.49
486 0.56
487 0.6
488 0.59
489 0.62
490 0.65
491 0.56
492 0.48
493 0.43
494 0.37
495 0.29
496 0.28
497 0.25
498 0.24
499 0.23
500 0.23
501 0.22
502 0.18
503 0.16
504 0.17
505 0.17
506 0.21
507 0.26
508 0.26
509 0.32
510 0.35
511 0.35
512 0.35