Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UH54

Protein Details
Accession A0A1Y1UH54   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
51-76LPTTRSKRTGWREKLRRKSHSDTTRNHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, mito 4, nucl 2, pero 2, golg 2, cyto 1, plas 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MAAIIIFLASLAAGKVVQVRREKKDKEHRVQHGLPPSYDDRSYSSLESSTLPTTRSKRTGWREKLRRKSHSDTTRNHTSTETASLAPPAYNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.1
3 0.13
4 0.19
5 0.28
6 0.34
7 0.42
8 0.51
9 0.55
10 0.6
11 0.68
12 0.73
13 0.75
14 0.79
15 0.78
16 0.77
17 0.77
18 0.72
19 0.7
20 0.61
21 0.5
22 0.44
23 0.39
24 0.33
25 0.3
26 0.25
27 0.19
28 0.2
29 0.22
30 0.18
31 0.16
32 0.14
33 0.14
34 0.14
35 0.13
36 0.12
37 0.11
38 0.12
39 0.16
40 0.19
41 0.23
42 0.26
43 0.26
44 0.34
45 0.44
46 0.53
47 0.59
48 0.67
49 0.73
50 0.8
51 0.88
52 0.88
53 0.86
54 0.84
55 0.81
56 0.81
57 0.81
58 0.79
59 0.75
60 0.74
61 0.76
62 0.69
63 0.62
64 0.53
65 0.45
66 0.38
67 0.36
68 0.31
69 0.21
70 0.2
71 0.21
72 0.21