Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UKV6

Protein Details
Accession A0A1Y1UKV6   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
89-120AQPAKEKSKAQLKNEKRREKKRLEASNKDWDDHydrophilic
NLS Segment(s)
PositionSequence
93-110KEKSKAQLKNEKRREKKR
271-324TSWRKEKPPAENPGKGAGAKSKGKSGNTKPAAGPKGAAEPPKPTSEPRVRKEVK
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MSLPPVNPEKTASGIIQDPRTLERIVPTSKRSDGSVRKELKIRPGFTPQEDIGRFRSNRQVAADARKGLVPGSNRPPPPKQPDPDNVFAQPAKEKSKAQLKNEKRREKKRLEASNKDWDDDEDGDEHVLEDGQTAVEIPGSKEATGGGIYNPEDSFTPFSNHGTPDPPAIQPKSQGSNIPASKPSDGANINWADMDDSPVGISASPPSAPELASAIQASASTSKSNPSEAAANSRTAGPAAKRHPIQGGRDGPLGLAHPPPIEQSKSDKATSWRKEKPPAENPGKGAGAKSKGKSGNTKPAAGPKGAAEPPKPTSEPRVRKEVKIRQGGVNDIGSLASRVRSLVLENQKPAAPRAKKENAAES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.31
4 0.3
5 0.29
6 0.29
7 0.31
8 0.28
9 0.24
10 0.24
11 0.28
12 0.33
13 0.37
14 0.38
15 0.41
16 0.44
17 0.45
18 0.43
19 0.46
20 0.49
21 0.52
22 0.58
23 0.58
24 0.59
25 0.64
26 0.64
27 0.65
28 0.64
29 0.59
30 0.54
31 0.57
32 0.58
33 0.54
34 0.56
35 0.47
36 0.47
37 0.45
38 0.43
39 0.39
40 0.42
41 0.4
42 0.38
43 0.46
44 0.4
45 0.42
46 0.43
47 0.44
48 0.41
49 0.49
50 0.5
51 0.42
52 0.4
53 0.38
54 0.34
55 0.28
56 0.27
57 0.22
58 0.24
59 0.3
60 0.37
61 0.39
62 0.45
63 0.51
64 0.55
65 0.61
66 0.63
67 0.6
68 0.61
69 0.67
70 0.69
71 0.68
72 0.62
73 0.54
74 0.49
75 0.44
76 0.37
77 0.32
78 0.29
79 0.29
80 0.29
81 0.29
82 0.33
83 0.43
84 0.48
85 0.51
86 0.58
87 0.63
88 0.71
89 0.8
90 0.84
91 0.84
92 0.88
93 0.9
94 0.88
95 0.87
96 0.86
97 0.87
98 0.86
99 0.85
100 0.81
101 0.81
102 0.73
103 0.64
104 0.54
105 0.44
106 0.38
107 0.29
108 0.24
109 0.14
110 0.13
111 0.12
112 0.12
113 0.11
114 0.07
115 0.06
116 0.05
117 0.04
118 0.04
119 0.04
120 0.03
121 0.04
122 0.04
123 0.05
124 0.05
125 0.05
126 0.09
127 0.1
128 0.1
129 0.09
130 0.09
131 0.09
132 0.09
133 0.09
134 0.06
135 0.07
136 0.08
137 0.09
138 0.09
139 0.08
140 0.08
141 0.09
142 0.12
143 0.11
144 0.13
145 0.12
146 0.14
147 0.16
148 0.16
149 0.16
150 0.16
151 0.15
152 0.15
153 0.16
154 0.16
155 0.18
156 0.19
157 0.19
158 0.19
159 0.21
160 0.23
161 0.22
162 0.23
163 0.21
164 0.27
165 0.27
166 0.26
167 0.25
168 0.24
169 0.23
170 0.22
171 0.2
172 0.17
173 0.17
174 0.15
175 0.17
176 0.16
177 0.15
178 0.15
179 0.14
180 0.1
181 0.1
182 0.12
183 0.07
184 0.06
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.04
191 0.05
192 0.05
193 0.06
194 0.07
195 0.07
196 0.07
197 0.08
198 0.09
199 0.08
200 0.09
201 0.09
202 0.07
203 0.07
204 0.07
205 0.07
206 0.07
207 0.07
208 0.07
209 0.08
210 0.11
211 0.12
212 0.13
213 0.13
214 0.13
215 0.16
216 0.16
217 0.22
218 0.2
219 0.2
220 0.2
221 0.2
222 0.18
223 0.15
224 0.16
225 0.12
226 0.18
227 0.21
228 0.27
229 0.27
230 0.29
231 0.35
232 0.38
233 0.39
234 0.41
235 0.42
236 0.38
237 0.38
238 0.37
239 0.3
240 0.26
241 0.23
242 0.16
243 0.12
244 0.1
245 0.09
246 0.1
247 0.12
248 0.15
249 0.15
250 0.16
251 0.22
252 0.29
253 0.32
254 0.33
255 0.34
256 0.38
257 0.47
258 0.54
259 0.56
260 0.58
261 0.6
262 0.7
263 0.72
264 0.75
265 0.73
266 0.75
267 0.74
268 0.69
269 0.65
270 0.6
271 0.56
272 0.46
273 0.39
274 0.35
275 0.33
276 0.35
277 0.34
278 0.36
279 0.4
280 0.44
281 0.51
282 0.53
283 0.57
284 0.55
285 0.58
286 0.52
287 0.57
288 0.55
289 0.47
290 0.4
291 0.31
292 0.34
293 0.34
294 0.36
295 0.29
296 0.31
297 0.34
298 0.38
299 0.38
300 0.34
301 0.4
302 0.47
303 0.55
304 0.54
305 0.62
306 0.6
307 0.67
308 0.75
309 0.75
310 0.74
311 0.73
312 0.73
313 0.68
314 0.67
315 0.63
316 0.56
317 0.47
318 0.37
319 0.28
320 0.24
321 0.18
322 0.15
323 0.12
324 0.1
325 0.09
326 0.09
327 0.1
328 0.11
329 0.14
330 0.22
331 0.31
332 0.36
333 0.39
334 0.41
335 0.42
336 0.43
337 0.45
338 0.46
339 0.42
340 0.42
341 0.5
342 0.56
343 0.61