Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UK94

Protein Details
Accession A0A1Y1UK94   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
100-125LVKAKMSAKKLQRMKKRQGRTKKINGHydrophilic
NLS Segment(s)
PositionSequence
21-125KNGRTAGKAHKESKSAARRSYLSRASKQGFEHRKELESKRQAMKGVEKEMKEEKEAEQERKRTAIKERRERQEEKQRLELVKAKMSAKKLQRMKKRQGRTKKING
Subcellular Location(s) nucl 18.5, mito_nucl 12.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MEVDNPSAGPSAPVRSLAASKNGRTAGKAHKESKSAARRSYLSRASKQGFEHRKELESKRQAMKGVEKEMKEEKEAEQERKRTAIKERRERQEEKQRLELVKAKMSAKKLQRMKKRQGRTKKING
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.21
4 0.21
5 0.28
6 0.29
7 0.29
8 0.34
9 0.36
10 0.35
11 0.33
12 0.36
13 0.37
14 0.42
15 0.48
16 0.48
17 0.48
18 0.5
19 0.52
20 0.57
21 0.57
22 0.52
23 0.48
24 0.47
25 0.45
26 0.48
27 0.52
28 0.51
29 0.47
30 0.46
31 0.49
32 0.48
33 0.48
34 0.46
35 0.48
36 0.48
37 0.46
38 0.46
39 0.41
40 0.41
41 0.44
42 0.45
43 0.45
44 0.43
45 0.45
46 0.44
47 0.44
48 0.43
49 0.39
50 0.42
51 0.36
52 0.37
53 0.36
54 0.32
55 0.33
56 0.36
57 0.35
58 0.3
59 0.27
60 0.21
61 0.26
62 0.3
63 0.34
64 0.36
65 0.38
66 0.39
67 0.42
68 0.43
69 0.37
70 0.43
71 0.45
72 0.49
73 0.57
74 0.64
75 0.69
76 0.75
77 0.77
78 0.76
79 0.79
80 0.77
81 0.71
82 0.7
83 0.66
84 0.6
85 0.6
86 0.57
87 0.5
88 0.47
89 0.45
90 0.41
91 0.41
92 0.44
93 0.47
94 0.48
95 0.53
96 0.57
97 0.63
98 0.7
99 0.75
100 0.82
101 0.84
102 0.87
103 0.88
104 0.91
105 0.92