Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2J317

Protein Details
Accession A0A1Y2J317   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
179-205TQTTSTQSEKKKGRKRRGKAARRGVKAHydrophilic
NLS Segment(s)
PositionSequence
129-156KWRRKLAPKLTIKLPPAKPAPSPLRRRT
188-205KKKGRKRRGKAARRGVKA
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSIAIRPPETPYRTAGPSVGRACWGLTSGRCLLLANLHLRLLATLTYPNVSVLISSLYTRGVKMDTTTTLHTSPSRLPLRWRRKLAPELVPDILPSTERAIAAAPSPPVDPTPKSAVEGAPSHSNLPFKWRRKLAPKLTIKLPPAKPAPSPLRRRTRSQTAASMAKTNVLASSEKLNATQTTSTQSEKKKGRKRRGKAARRGVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.32
4 0.36
5 0.36
6 0.33
7 0.29
8 0.27
9 0.26
10 0.23
11 0.21
12 0.17
13 0.15
14 0.19
15 0.19
16 0.2
17 0.19
18 0.19
19 0.18
20 0.18
21 0.21
22 0.19
23 0.19
24 0.18
25 0.18
26 0.17
27 0.17
28 0.14
29 0.1
30 0.08
31 0.08
32 0.09
33 0.09
34 0.1
35 0.1
36 0.09
37 0.08
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.09
45 0.09
46 0.1
47 0.1
48 0.09
49 0.09
50 0.1
51 0.12
52 0.12
53 0.15
54 0.17
55 0.18
56 0.18
57 0.19
58 0.18
59 0.18
60 0.18
61 0.24
62 0.26
63 0.24
64 0.32
65 0.41
66 0.51
67 0.58
68 0.62
69 0.58
70 0.62
71 0.67
72 0.64
73 0.61
74 0.54
75 0.49
76 0.44
77 0.39
78 0.32
79 0.27
80 0.2
81 0.13
82 0.1
83 0.08
84 0.08
85 0.08
86 0.08
87 0.08
88 0.08
89 0.08
90 0.09
91 0.07
92 0.07
93 0.07
94 0.07
95 0.08
96 0.1
97 0.1
98 0.12
99 0.16
100 0.16
101 0.17
102 0.18
103 0.17
104 0.18
105 0.18
106 0.17
107 0.16
108 0.16
109 0.16
110 0.17
111 0.18
112 0.14
113 0.22
114 0.29
115 0.31
116 0.39
117 0.43
118 0.48
119 0.56
120 0.67
121 0.68
122 0.69
123 0.71
124 0.68
125 0.69
126 0.68
127 0.62
128 0.61
129 0.53
130 0.49
131 0.45
132 0.43
133 0.39
134 0.41
135 0.48
136 0.48
137 0.56
138 0.59
139 0.66
140 0.67
141 0.73
142 0.73
143 0.74
144 0.73
145 0.68
146 0.66
147 0.61
148 0.63
149 0.57
150 0.52
151 0.41
152 0.36
153 0.31
154 0.24
155 0.19
156 0.15
157 0.14
158 0.12
159 0.17
160 0.17
161 0.17
162 0.18
163 0.19
164 0.18
165 0.21
166 0.21
167 0.17
168 0.21
169 0.23
170 0.26
171 0.31
172 0.36
173 0.42
174 0.5
175 0.59
176 0.64
177 0.72
178 0.8
179 0.84
180 0.88
181 0.9
182 0.92
183 0.92
184 0.93
185 0.93