Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2IQB6

Protein Details
Accession A0A1Y2IQB6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
24-43RDECRTKRSRGACRRRGRGEBasic
NLS Segment(s)
Subcellular Location(s) cyto 8, E.R. 5, cyto_pero 5, mito 4, plas 4
Family & Domain DBs
Amino Acid Sequences MVSVGVGCVMGATLVAMVLGPEPRDECRTKRSRGACRRRGRGEDAGKLWYSKDRRGMTTSLLRRGARGRQVEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.03
3 0.02
4 0.03
5 0.04
6 0.05
7 0.05
8 0.06
9 0.07
10 0.1
11 0.14
12 0.17
13 0.2
14 0.29
15 0.35
16 0.39
17 0.45
18 0.52
19 0.58
20 0.66
21 0.74
22 0.74
23 0.76
24 0.81
25 0.79
26 0.75
27 0.7
28 0.68
29 0.63
30 0.59
31 0.52
32 0.46
33 0.41
34 0.36
35 0.31
36 0.29
37 0.27
38 0.26
39 0.33
40 0.33
41 0.36
42 0.4
43 0.41
44 0.4
45 0.46
46 0.48
47 0.46
48 0.49
49 0.46
50 0.46
51 0.49
52 0.51
53 0.5