Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2IMX1

Protein Details
Accession A0A1Y2IMX1   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
22-48LTVPLSAGRRRRRRQALPVAKYRRRGFHydrophilic
NLS Segment(s)
PositionSequence
29-45GRRRRRRQALPVAKYRR
Subcellular Location(s) mito 16, extr 4, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MRIASSAPGPTTSYSLRGAAALTVPLSAGRRRRRRQALPVAKYRRRGFVVCTYSLSRRDIRIREQDDGVDRSQRGEGRTKRNVKLQSSRSRPPRTVRAHGRDDALRISESCSSPCFERAQIMIPNASSCDGGSDVRVARAWCGCIARAMHCSWGRRFSSSESWPWVDLPGKADTYSSSVARRFGTTSREGLSPSPISDSTPALGLAGSRQCYRAEVALGNGARV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.2
4 0.19
5 0.18
6 0.14
7 0.14
8 0.11
9 0.1
10 0.08
11 0.08
12 0.09
13 0.12
14 0.16
15 0.24
16 0.34
17 0.44
18 0.52
19 0.62
20 0.71
21 0.78
22 0.84
23 0.86
24 0.87
25 0.85
26 0.88
27 0.88
28 0.83
29 0.83
30 0.75
31 0.7
32 0.63
33 0.57
34 0.52
35 0.51
36 0.51
37 0.44
38 0.45
39 0.41
40 0.41
41 0.42
42 0.4
43 0.32
44 0.32
45 0.38
46 0.38
47 0.42
48 0.48
49 0.49
50 0.49
51 0.47
52 0.45
53 0.42
54 0.4
55 0.34
56 0.28
57 0.24
58 0.22
59 0.24
60 0.23
61 0.22
62 0.28
63 0.34
64 0.39
65 0.49
66 0.55
67 0.55
68 0.61
69 0.65
70 0.62
71 0.64
72 0.64
73 0.64
74 0.64
75 0.68
76 0.7
77 0.69
78 0.67
79 0.64
80 0.65
81 0.62
82 0.64
83 0.66
84 0.63
85 0.62
86 0.6
87 0.56
88 0.47
89 0.42
90 0.33
91 0.25
92 0.18
93 0.13
94 0.13
95 0.14
96 0.13
97 0.12
98 0.12
99 0.12
100 0.12
101 0.14
102 0.14
103 0.11
104 0.12
105 0.12
106 0.15
107 0.16
108 0.17
109 0.15
110 0.14
111 0.14
112 0.13
113 0.12
114 0.09
115 0.06
116 0.06
117 0.07
118 0.07
119 0.07
120 0.09
121 0.08
122 0.09
123 0.11
124 0.1
125 0.1
126 0.11
127 0.12
128 0.11
129 0.12
130 0.12
131 0.13
132 0.15
133 0.15
134 0.17
135 0.17
136 0.22
137 0.24
138 0.28
139 0.27
140 0.34
141 0.33
142 0.32
143 0.34
144 0.32
145 0.37
146 0.36
147 0.38
148 0.36
149 0.36
150 0.34
151 0.33
152 0.3
153 0.24
154 0.22
155 0.21
156 0.18
157 0.18
158 0.17
159 0.17
160 0.15
161 0.17
162 0.19
163 0.18
164 0.18
165 0.19
166 0.22
167 0.23
168 0.23
169 0.22
170 0.23
171 0.27
172 0.26
173 0.28
174 0.28
175 0.27
176 0.27
177 0.26
178 0.28
179 0.24
180 0.21
181 0.22
182 0.2
183 0.21
184 0.21
185 0.22
186 0.17
187 0.17
188 0.16
189 0.12
190 0.12
191 0.1
192 0.13
193 0.16
194 0.18
195 0.18
196 0.2
197 0.2
198 0.22
199 0.24
200 0.23
201 0.21
202 0.2
203 0.21
204 0.27