Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2I8P6

Protein Details
Accession A0A1Y2I8P6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
25-44VLAKHAAKRRSIRRLQRPLVHydrophilic
NLS Segment(s)
PositionSequence
28-62KHAAKRRSIRRLQRPLVGRPQRGVRTKSAKKRARR
Subcellular Location(s) mito 23, extr 3
Family & Domain DBs
Amino Acid Sequences MGTRRHRIYPTQPSRSLAFTCLWAVLAKHAAKRRSIRRLQRPLVGRPQRGVRTKSAKKRARRSSVFRTLQGAVRVDHDVNGALRIRLSLLPRVGRTSHLPAVFQYGGTNRVGKPEHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.59
3 0.5
4 0.41
5 0.31
6 0.24
7 0.22
8 0.19
9 0.17
10 0.14
11 0.13
12 0.12
13 0.17
14 0.17
15 0.22
16 0.28
17 0.3
18 0.36
19 0.44
20 0.51
21 0.55
22 0.63
23 0.68
24 0.73
25 0.81
26 0.78
27 0.77
28 0.72
29 0.68
30 0.7
31 0.67
32 0.58
33 0.5
34 0.53
35 0.53
36 0.54
37 0.5
38 0.47
39 0.49
40 0.56
41 0.63
42 0.66
43 0.67
44 0.7
45 0.77
46 0.8
47 0.79
48 0.78
49 0.77
50 0.76
51 0.79
52 0.73
53 0.64
54 0.57
55 0.49
56 0.45
57 0.4
58 0.32
59 0.21
60 0.2
61 0.21
62 0.17
63 0.16
64 0.13
65 0.12
66 0.11
67 0.12
68 0.11
69 0.09
70 0.09
71 0.09
72 0.1
73 0.12
74 0.14
75 0.17
76 0.2
77 0.24
78 0.26
79 0.29
80 0.28
81 0.29
82 0.32
83 0.34
84 0.35
85 0.33
86 0.32
87 0.29
88 0.35
89 0.32
90 0.27
91 0.23
92 0.19
93 0.2
94 0.21
95 0.24
96 0.17
97 0.24