Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2J1E0

Protein Details
Accession A0A1Y2J1E0   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKCRTYRTCEQKYRRWYGARRRSKGCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MKCRTYRTCEQKYRRWYGARRRSKGCLYSIRRASRGRVHSVNMTCSISYIGIATGIRNRPLHAAQISPRKPHIGLEVPVTLILLSDRTKGRDRQQRPTERAFQHGRHTTCKTRQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.79
4 0.8
5 0.82
6 0.83
7 0.81
8 0.78
9 0.77
10 0.75
11 0.71
12 0.67
13 0.66
14 0.63
15 0.65
16 0.68
17 0.66
18 0.63
19 0.6
20 0.58
21 0.56
22 0.54
23 0.52
24 0.46
25 0.43
26 0.45
27 0.45
28 0.42
29 0.36
30 0.31
31 0.24
32 0.21
33 0.19
34 0.12
35 0.1
36 0.08
37 0.05
38 0.05
39 0.05
40 0.06
41 0.09
42 0.1
43 0.13
44 0.13
45 0.13
46 0.15
47 0.16
48 0.19
49 0.16
50 0.17
51 0.2
52 0.3
53 0.32
54 0.31
55 0.32
56 0.3
57 0.3
58 0.29
59 0.29
60 0.25
61 0.23
62 0.25
63 0.24
64 0.22
65 0.22
66 0.2
67 0.14
68 0.09
69 0.08
70 0.06
71 0.07
72 0.1
73 0.12
74 0.16
75 0.21
76 0.27
77 0.36
78 0.45
79 0.5
80 0.57
81 0.67
82 0.73
83 0.75
84 0.78
85 0.78
86 0.7
87 0.72
88 0.69
89 0.62
90 0.62
91 0.64
92 0.6
93 0.58
94 0.62
95 0.63