Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NRU4

Protein Details
Accession G9NRU4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
142-202LEKKEEVKKDEKKVEKKDEKKVEKKNEKKVEKKDEKKVEKKDEKKGEKKDEKKKKDEKGKABasic
NLS Segment(s)
PositionSequence
145-202KEEVKKDEKKVEKKDEKKVEKKNEKKVEKKDEKKVEKKDEKKGEKKDEKKKKDEKGKA
Subcellular Location(s) nucl 12, cyto_nucl 11.5, cyto 9, mito 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029068  Glyas_Bleomycin-R_OHBP_Dase  
Amino Acid Sequences MPTVNPPSFFISLPVASLNSATDFYKSLSFTPLPDFSDANTSAFRFPYRSNSNICLMLHSTRRFGEFVRQGSEIINAKKFTGAIYTLGVASRDDVDGLLEKAERGGGKKDPFKMEGYGKSVGIYTRSFEDVDGHVWEATTMLEKKEEVKKDEKKVEKKDEKKVEKKNEKKVEKKDEKKVEKKDEKKGEKKDEKKKKDEKGKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.16
3 0.15
4 0.15
5 0.13
6 0.1
7 0.11
8 0.11
9 0.11
10 0.12
11 0.13
12 0.16
13 0.16
14 0.15
15 0.19
16 0.19
17 0.2
18 0.24
19 0.25
20 0.24
21 0.25
22 0.24
23 0.2
24 0.25
25 0.25
26 0.21
27 0.2
28 0.19
29 0.18
30 0.19
31 0.19
32 0.16
33 0.17
34 0.25
35 0.29
36 0.31
37 0.34
38 0.36
39 0.38
40 0.39
41 0.37
42 0.3
43 0.27
44 0.28
45 0.3
46 0.28
47 0.27
48 0.24
49 0.26
50 0.24
51 0.23
52 0.28
53 0.27
54 0.28
55 0.29
56 0.29
57 0.28
58 0.27
59 0.3
60 0.25
61 0.22
62 0.22
63 0.19
64 0.19
65 0.19
66 0.19
67 0.15
68 0.13
69 0.11
70 0.09
71 0.09
72 0.09
73 0.09
74 0.09
75 0.09
76 0.07
77 0.07
78 0.06
79 0.06
80 0.05
81 0.05
82 0.05
83 0.06
84 0.06
85 0.06
86 0.05
87 0.05
88 0.05
89 0.06
90 0.06
91 0.06
92 0.09
93 0.13
94 0.18
95 0.22
96 0.26
97 0.28
98 0.3
99 0.3
100 0.31
101 0.31
102 0.29
103 0.29
104 0.27
105 0.24
106 0.22
107 0.21
108 0.18
109 0.16
110 0.13
111 0.1
112 0.11
113 0.12
114 0.12
115 0.11
116 0.13
117 0.12
118 0.13
119 0.13
120 0.12
121 0.11
122 0.1
123 0.1
124 0.08
125 0.07
126 0.09
127 0.09
128 0.09
129 0.1
130 0.11
131 0.16
132 0.23
133 0.28
134 0.29
135 0.38
136 0.45
137 0.53
138 0.63
139 0.67
140 0.69
141 0.75
142 0.81
143 0.82
144 0.82
145 0.84
146 0.85
147 0.86
148 0.86
149 0.87
150 0.87
151 0.88
152 0.89
153 0.89
154 0.89
155 0.89
156 0.89
157 0.89
158 0.89
159 0.89
160 0.89
161 0.89
162 0.89
163 0.89
164 0.89
165 0.89
166 0.89
167 0.88
168 0.87
169 0.88
170 0.88
171 0.88
172 0.88
173 0.88
174 0.89
175 0.89
176 0.91
177 0.91
178 0.91
179 0.91
180 0.92
181 0.91
182 0.91