Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2IBG4

Protein Details
Accession A0A1Y2IBG4    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
44-63QTPPRSRSHPRGRRLRDRATBasic
NLS Segment(s)
PositionSequence
47-58PRSRSHPRGRRL
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR046521  DUF6698  
Pfam View protein in Pfam  
PF20414  DUF6698  
Amino Acid Sequences MPRCEPPYVPLEERSRSGFCSHSRSRCRERSSSPRYRLGAGGHQTPPRSRSHPRGRRLRDRATQPPTLLEQQYISMVEDFKEPQAHRWRVKSTVSISRMHGIDNVTPENIAYIVCLLRHILSSETSWRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.39
3 0.35
4 0.34
5 0.32
6 0.3
7 0.36
8 0.42
9 0.47
10 0.53
11 0.6
12 0.67
13 0.71
14 0.73
15 0.72
16 0.73
17 0.74
18 0.75
19 0.78
20 0.74
21 0.73
22 0.68
23 0.63
24 0.56
25 0.48
26 0.45
27 0.38
28 0.37
29 0.33
30 0.34
31 0.34
32 0.33
33 0.33
34 0.29
35 0.32
36 0.32
37 0.39
38 0.47
39 0.55
40 0.62
41 0.7
42 0.74
43 0.8
44 0.82
45 0.8
46 0.75
47 0.74
48 0.74
49 0.68
50 0.63
51 0.52
52 0.46
53 0.4
54 0.36
55 0.29
56 0.2
57 0.15
58 0.13
59 0.13
60 0.12
61 0.1
62 0.08
63 0.07
64 0.07
65 0.08
66 0.08
67 0.09
68 0.13
69 0.13
70 0.2
71 0.3
72 0.37
73 0.4
74 0.45
75 0.48
76 0.47
77 0.5
78 0.48
79 0.43
80 0.46
81 0.44
82 0.42
83 0.4
84 0.4
85 0.38
86 0.33
87 0.3
88 0.22
89 0.22
90 0.23
91 0.22
92 0.17
93 0.17
94 0.16
95 0.15
96 0.13
97 0.1
98 0.07
99 0.07
100 0.07
101 0.07
102 0.08
103 0.09
104 0.09
105 0.1
106 0.12
107 0.12
108 0.13
109 0.16