Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2IWE5

Protein Details
Accession A0A1Y2IWE5   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
81-123PLDLRPKKTRAIRRRLTKHEASLKTLKQRKKEIHFPLRKYAVKHydrophilic
NLS Segment(s)
PositionSequence
75-119KKKKYMPLDLRPKKTRAIRRRLTKHEASLKTLKQRKKEIHFPLRK
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLSNQLKELKTELLNLRVQKIAGGSAAKLTKINTVRKSIARVLTVMNQKQRQNLREFYKKKKYMPLDLRPKKTRAIRRRLTKHEASLKTLKQRKKEIHFPLRKYAVKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.53
3 0.46
4 0.52
5 0.5
6 0.51
7 0.5
8 0.52
9 0.47
10 0.43
11 0.43
12 0.36
13 0.31
14 0.29
15 0.28
16 0.26
17 0.3
18 0.3
19 0.3
20 0.27
21 0.26
22 0.21
23 0.19
24 0.14
25 0.12
26 0.11
27 0.09
28 0.12
29 0.13
30 0.12
31 0.13
32 0.13
33 0.17
34 0.22
35 0.29
36 0.29
37 0.33
38 0.36
39 0.37
40 0.41
41 0.39
42 0.36
43 0.3
44 0.27
45 0.24
46 0.26
47 0.3
48 0.29
49 0.3
50 0.31
51 0.32
52 0.37
53 0.41
54 0.39
55 0.39
56 0.43
57 0.45
58 0.5
59 0.55
60 0.58
61 0.64
62 0.65
63 0.63
64 0.66
65 0.64
66 0.64
67 0.68
68 0.69
69 0.7
70 0.73
71 0.79
72 0.74
73 0.71
74 0.68
75 0.67
76 0.68
77 0.67
78 0.69
79 0.7
80 0.76
81 0.83
82 0.85
83 0.84
84 0.79
85 0.78
86 0.77
87 0.71
88 0.67
89 0.65
90 0.62
91 0.64
92 0.66
93 0.63
94 0.61
95 0.68
96 0.71
97 0.72
98 0.76
99 0.77
100 0.8
101 0.84
102 0.81
103 0.81
104 0.81
105 0.76