Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NK51

Protein Details
Accession G9NK51   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
227-255SSNGGAPRKPGRPKKNGNKEKKTAPPPAVHydrophilic
NLS Segment(s)
PositionSequence
231-262GAPRKPGRPKKNGNKEKKTAPPPAVGRTARKT
Subcellular Location(s) cyto 19.5, cyto_nucl 12.833, nucl 5, mito_nucl 3.833
Family & Domain DBs
Amino Acid Sequences MADGIAPAVDKVGAPEPTAPEALAGAPTLDTAKPEVSENPPAQAEPAKELPIVGETKGPEEAKPSTEPFNVVDAFKRAHQIPRPVEVQSVPETPANQSVNGSPKPELNIPMETGESPKPQEEPVVITGVEEPLPTPAASVPNSDNGPDSIVDKPVTPNGDSKTAEMAGALQTGNDDDKSDVSEIVIGEKRKLAEGPADVPAAASDKEDSDESEPADKKAKIDDGEASSNGGAPRKPGRPKKNGNKEKKTAPPPAVGRTARKTRSQGPVEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.21
4 0.23
5 0.24
6 0.21
7 0.16
8 0.16
9 0.15
10 0.12
11 0.09
12 0.07
13 0.06
14 0.07
15 0.09
16 0.08
17 0.09
18 0.1
19 0.11
20 0.12
21 0.14
22 0.18
23 0.21
24 0.29
25 0.28
26 0.29
27 0.29
28 0.28
29 0.28
30 0.28
31 0.24
32 0.22
33 0.24
34 0.22
35 0.21
36 0.21
37 0.2
38 0.19
39 0.19
40 0.14
41 0.14
42 0.13
43 0.15
44 0.19
45 0.19
46 0.16
47 0.19
48 0.2
49 0.21
50 0.23
51 0.24
52 0.24
53 0.24
54 0.26
55 0.23
56 0.25
57 0.23
58 0.2
59 0.2
60 0.18
61 0.19
62 0.18
63 0.2
64 0.18
65 0.24
66 0.29
67 0.36
68 0.37
69 0.4
70 0.41
71 0.38
72 0.38
73 0.32
74 0.29
75 0.24
76 0.22
77 0.18
78 0.17
79 0.17
80 0.17
81 0.22
82 0.2
83 0.17
84 0.16
85 0.17
86 0.22
87 0.23
88 0.23
89 0.18
90 0.19
91 0.21
92 0.22
93 0.22
94 0.19
95 0.19
96 0.18
97 0.18
98 0.17
99 0.15
100 0.16
101 0.15
102 0.13
103 0.13
104 0.12
105 0.12
106 0.12
107 0.13
108 0.11
109 0.12
110 0.12
111 0.12
112 0.11
113 0.11
114 0.11
115 0.1
116 0.1
117 0.07
118 0.05
119 0.05
120 0.06
121 0.05
122 0.05
123 0.06
124 0.08
125 0.09
126 0.1
127 0.1
128 0.13
129 0.13
130 0.13
131 0.13
132 0.11
133 0.11
134 0.1
135 0.11
136 0.09
137 0.1
138 0.1
139 0.1
140 0.11
141 0.12
142 0.14
143 0.13
144 0.16
145 0.16
146 0.21
147 0.22
148 0.21
149 0.21
150 0.2
151 0.18
152 0.15
153 0.13
154 0.08
155 0.09
156 0.08
157 0.05
158 0.05
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.06
165 0.08
166 0.09
167 0.08
168 0.07
169 0.09
170 0.08
171 0.12
172 0.15
173 0.14
174 0.14
175 0.16
176 0.16
177 0.16
178 0.16
179 0.14
180 0.14
181 0.16
182 0.18
183 0.19
184 0.18
185 0.17
186 0.17
187 0.16
188 0.13
189 0.11
190 0.09
191 0.08
192 0.08
193 0.1
194 0.1
195 0.12
196 0.13
197 0.14
198 0.15
199 0.21
200 0.21
201 0.22
202 0.28
203 0.26
204 0.25
205 0.28
206 0.32
207 0.26
208 0.28
209 0.31
210 0.3
211 0.33
212 0.32
213 0.29
214 0.23
215 0.24
216 0.23
217 0.2
218 0.16
219 0.17
220 0.24
221 0.31
222 0.41
223 0.5
224 0.59
225 0.67
226 0.78
227 0.85
228 0.89
229 0.92
230 0.93
231 0.93
232 0.9
233 0.89
234 0.88
235 0.85
236 0.83
237 0.77
238 0.74
239 0.69
240 0.68
241 0.68
242 0.62
243 0.61
244 0.61
245 0.66
246 0.62
247 0.64
248 0.65
249 0.64
250 0.69