Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2IYY3

Protein Details
Accession A0A1Y2IYY3    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
172-201RSPSAALRDKRDKRKDRRRWKTLRDFVDERBasic
NLS Segment(s)
PositionSequence
177-192ALRDKRDKRKDRRRWK
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 6.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007240  Atg17  
IPR045326  ATG17-like_dom  
Gene Ontology GO:0034045  C:phagophore assembly site membrane  
GO:0000422  P:autophagy of mitochondrion  
Pfam View protein in Pfam  
PF04108  ATG17_like  
Amino Acid Sequences MPDSRSPSSTGACSPSEQPHIVSLALQAKKALLQGQQLCSQASALSSESAQISVDVLALDAQVRWMSEAVLDQLKLAAQVAKSIEQKRSELETQVQEWDALRSQRSDALDDVLESLGAQSVPPDFHTGSVDSSPFGSQNPSEDENEDDTTSFGLPKSSSNPRESPTDTIRNRSPSAALRDKRDKRKDRRRWKTLRDFVDERALEELLDTIETDRQKLDDILARTSDYPESLAKAIGDIKETLPEAIELPRFNTIFAAQGHTSSRMAEQLESLAHHYDNMTNAMHDFEAGEEFSEEDLLGMNSDADALPNIILELEGGIHTIEAHRDELLAAKAAAQTHLETHRRILQDLDTLGEVMTDILDHQHHVEIESLKHLSDLHMQLSPLEELHHKYTSYQYAYNNLVLELARRRQYREAAQRVISNMIAELDTMVEEERGLRAAFQAQHGQYIPEDICLYIENPPNRWTVSTWNDEPLETLPEIENDLIEEAKQRVSGIEVGIGTSQSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.38
4 0.36
5 0.33
6 0.32
7 0.32
8 0.29
9 0.25
10 0.24
11 0.27
12 0.27
13 0.26
14 0.24
15 0.23
16 0.24
17 0.26
18 0.25
19 0.2
20 0.27
21 0.33
22 0.37
23 0.41
24 0.41
25 0.39
26 0.35
27 0.31
28 0.23
29 0.17
30 0.15
31 0.11
32 0.11
33 0.1
34 0.12
35 0.12
36 0.12
37 0.11
38 0.09
39 0.09
40 0.08
41 0.08
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.05
48 0.06
49 0.07
50 0.07
51 0.08
52 0.08
53 0.08
54 0.08
55 0.09
56 0.12
57 0.14
58 0.14
59 0.12
60 0.13
61 0.13
62 0.12
63 0.12
64 0.12
65 0.09
66 0.13
67 0.15
68 0.19
69 0.26
70 0.3
71 0.35
72 0.35
73 0.36
74 0.37
75 0.41
76 0.38
77 0.36
78 0.37
79 0.36
80 0.35
81 0.36
82 0.33
83 0.27
84 0.25
85 0.24
86 0.21
87 0.19
88 0.19
89 0.18
90 0.19
91 0.23
92 0.24
93 0.23
94 0.2
95 0.21
96 0.19
97 0.18
98 0.18
99 0.13
100 0.11
101 0.09
102 0.08
103 0.06
104 0.06
105 0.05
106 0.05
107 0.06
108 0.07
109 0.08
110 0.12
111 0.11
112 0.12
113 0.14
114 0.15
115 0.16
116 0.17
117 0.16
118 0.13
119 0.14
120 0.13
121 0.12
122 0.11
123 0.12
124 0.1
125 0.13
126 0.17
127 0.19
128 0.2
129 0.2
130 0.23
131 0.23
132 0.24
133 0.22
134 0.17
135 0.14
136 0.14
137 0.13
138 0.11
139 0.08
140 0.08
141 0.08
142 0.1
143 0.15
144 0.24
145 0.28
146 0.33
147 0.36
148 0.36
149 0.41
150 0.42
151 0.42
152 0.4
153 0.45
154 0.42
155 0.44
156 0.47
157 0.46
158 0.45
159 0.4
160 0.36
161 0.32
162 0.38
163 0.43
164 0.41
165 0.44
166 0.53
167 0.61
168 0.68
169 0.74
170 0.76
171 0.77
172 0.86
173 0.9
174 0.91
175 0.93
176 0.93
177 0.93
178 0.93
179 0.93
180 0.9
181 0.86
182 0.82
183 0.74
184 0.65
185 0.63
186 0.52
187 0.42
188 0.34
189 0.27
190 0.19
191 0.17
192 0.15
193 0.06
194 0.06
195 0.05
196 0.04
197 0.08
198 0.08
199 0.08
200 0.08
201 0.09
202 0.09
203 0.1
204 0.11
205 0.12
206 0.14
207 0.15
208 0.15
209 0.16
210 0.15
211 0.16
212 0.15
213 0.1
214 0.1
215 0.09
216 0.1
217 0.1
218 0.1
219 0.08
220 0.08
221 0.1
222 0.09
223 0.1
224 0.09
225 0.09
226 0.1
227 0.1
228 0.09
229 0.08
230 0.07
231 0.07
232 0.08
233 0.1
234 0.08
235 0.09
236 0.12
237 0.12
238 0.12
239 0.11
240 0.1
241 0.11
242 0.11
243 0.14
244 0.11
245 0.13
246 0.13
247 0.14
248 0.14
249 0.12
250 0.12
251 0.1
252 0.11
253 0.1
254 0.09
255 0.08
256 0.09
257 0.09
258 0.09
259 0.08
260 0.07
261 0.07
262 0.08
263 0.08
264 0.08
265 0.1
266 0.09
267 0.08
268 0.08
269 0.09
270 0.08
271 0.07
272 0.06
273 0.05
274 0.05
275 0.05
276 0.05
277 0.04
278 0.05
279 0.05
280 0.05
281 0.04
282 0.04
283 0.04
284 0.04
285 0.04
286 0.04
287 0.03
288 0.03
289 0.04
290 0.04
291 0.03
292 0.04
293 0.04
294 0.04
295 0.04
296 0.04
297 0.03
298 0.03
299 0.03
300 0.03
301 0.03
302 0.03
303 0.03
304 0.03
305 0.03
306 0.03
307 0.04
308 0.05
309 0.06
310 0.07
311 0.06
312 0.07
313 0.07
314 0.09
315 0.09
316 0.09
317 0.08
318 0.08
319 0.1
320 0.1
321 0.11
322 0.09
323 0.09
324 0.11
325 0.18
326 0.2
327 0.19
328 0.22
329 0.27
330 0.27
331 0.27
332 0.26
333 0.21
334 0.22
335 0.22
336 0.2
337 0.15
338 0.14
339 0.13
340 0.11
341 0.09
342 0.05
343 0.04
344 0.03
345 0.03
346 0.04
347 0.05
348 0.06
349 0.07
350 0.08
351 0.09
352 0.1
353 0.13
354 0.14
355 0.14
356 0.17
357 0.16
358 0.15
359 0.15
360 0.14
361 0.13
362 0.18
363 0.19
364 0.18
365 0.19
366 0.19
367 0.19
368 0.2
369 0.19
370 0.12
371 0.12
372 0.12
373 0.14
374 0.18
375 0.2
376 0.18
377 0.19
378 0.24
379 0.29
380 0.3
381 0.31
382 0.28
383 0.32
384 0.34
385 0.35
386 0.3
387 0.24
388 0.21
389 0.17
390 0.19
391 0.2
392 0.23
393 0.28
394 0.29
395 0.33
396 0.38
397 0.45
398 0.51
399 0.56
400 0.59
401 0.58
402 0.59
403 0.58
404 0.54
405 0.5
406 0.4
407 0.29
408 0.21
409 0.16
410 0.13
411 0.1
412 0.09
413 0.06
414 0.06
415 0.06
416 0.06
417 0.05
418 0.05
419 0.06
420 0.06
421 0.08
422 0.08
423 0.08
424 0.09
425 0.14
426 0.16
427 0.19
428 0.26
429 0.25
430 0.29
431 0.29
432 0.29
433 0.24
434 0.26
435 0.23
436 0.17
437 0.17
438 0.13
439 0.14
440 0.14
441 0.14
442 0.17
443 0.24
444 0.25
445 0.27
446 0.29
447 0.31
448 0.31
449 0.32
450 0.28
451 0.3
452 0.34
453 0.39
454 0.39
455 0.43
456 0.42
457 0.4
458 0.4
459 0.32
460 0.3
461 0.22
462 0.21
463 0.16
464 0.16
465 0.18
466 0.16
467 0.14
468 0.11
469 0.12
470 0.11
471 0.1
472 0.13
473 0.12
474 0.14
475 0.14
476 0.14
477 0.13
478 0.16
479 0.18
480 0.16
481 0.18
482 0.16
483 0.17
484 0.17