Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2IAH5

Protein Details
Accession A0A1Y2IAH5   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
28-58LQRTLACRTPRSKRIRRARIRHGPALRQRDRHydrophilic
NLS Segment(s)
PositionSequence
37-56PRSKRIRRARIRHGPALRQR
Subcellular Location(s) mito 15, nucl 8, cyto 2
Family & Domain DBs
Amino Acid Sequences MSGWCSPVFTSARGALRHVSCAYGWSALQRTLACRTPRSKRIRRARIRHGPALRQRDRDSVQRGVLQRDGARESVRQRSEGAGGTLRGRRRRSLDDAALTLPPGGHHDDERVVKRRPISPCSGCCHHAYFAMTLVQQPGDGHREPGMWVTPTESPQRDDDKTGTRGNSSRRSAQADSAVGTVQSSGSRGEIPALAKMGRARSRTRLQVSVWPPAIPGAPRRLRSLCPSPAFLPSHSGAFRPLSLSSPRAAFASLCVVPSAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.33
4 0.37
5 0.33
6 0.29
7 0.23
8 0.24
9 0.24
10 0.19
11 0.17
12 0.17
13 0.19
14 0.19
15 0.22
16 0.21
17 0.23
18 0.26
19 0.33
20 0.33
21 0.37
22 0.43
23 0.5
24 0.59
25 0.66
26 0.71
27 0.74
28 0.82
29 0.86
30 0.89
31 0.9
32 0.91
33 0.91
34 0.89
35 0.88
36 0.84
37 0.82
38 0.8
39 0.81
40 0.76
41 0.72
42 0.67
43 0.65
44 0.62
45 0.6
46 0.57
47 0.51
48 0.47
49 0.46
50 0.46
51 0.42
52 0.4
53 0.35
54 0.31
55 0.29
56 0.29
57 0.24
58 0.23
59 0.24
60 0.26
61 0.32
62 0.32
63 0.29
64 0.28
65 0.28
66 0.29
67 0.27
68 0.24
69 0.17
70 0.17
71 0.19
72 0.22
73 0.26
74 0.3
75 0.31
76 0.34
77 0.38
78 0.43
79 0.47
80 0.5
81 0.5
82 0.46
83 0.45
84 0.42
85 0.36
86 0.3
87 0.22
88 0.15
89 0.1
90 0.09
91 0.1
92 0.09
93 0.09
94 0.11
95 0.14
96 0.18
97 0.23
98 0.27
99 0.27
100 0.28
101 0.31
102 0.36
103 0.37
104 0.37
105 0.4
106 0.4
107 0.43
108 0.46
109 0.46
110 0.42
111 0.39
112 0.37
113 0.29
114 0.26
115 0.22
116 0.17
117 0.15
118 0.14
119 0.12
120 0.1
121 0.1
122 0.08
123 0.07
124 0.07
125 0.07
126 0.1
127 0.1
128 0.11
129 0.11
130 0.11
131 0.12
132 0.13
133 0.13
134 0.09
135 0.09
136 0.11
137 0.11
138 0.14
139 0.18
140 0.18
141 0.18
142 0.21
143 0.26
144 0.25
145 0.26
146 0.27
147 0.28
148 0.31
149 0.32
150 0.3
151 0.28
152 0.3
153 0.34
154 0.4
155 0.38
156 0.39
157 0.39
158 0.44
159 0.43
160 0.42
161 0.39
162 0.31
163 0.29
164 0.24
165 0.21
166 0.15
167 0.13
168 0.1
169 0.07
170 0.06
171 0.06
172 0.06
173 0.06
174 0.07
175 0.07
176 0.08
177 0.1
178 0.11
179 0.12
180 0.13
181 0.12
182 0.13
183 0.16
184 0.22
185 0.25
186 0.28
187 0.31
188 0.37
189 0.44
190 0.51
191 0.54
192 0.51
193 0.48
194 0.53
195 0.53
196 0.54
197 0.48
198 0.39
199 0.34
200 0.31
201 0.31
202 0.23
203 0.24
204 0.26
205 0.31
206 0.33
207 0.39
208 0.41
209 0.43
210 0.49
211 0.53
212 0.52
213 0.49
214 0.51
215 0.47
216 0.51
217 0.49
218 0.42
219 0.39
220 0.31
221 0.33
222 0.29
223 0.28
224 0.24
225 0.24
226 0.24
227 0.21
228 0.2
229 0.2
230 0.23
231 0.24
232 0.24
233 0.23
234 0.23
235 0.22
236 0.22
237 0.18
238 0.15
239 0.2
240 0.19
241 0.18