Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2J2H1

Protein Details
Accession A0A1Y2J2H1    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRSAKFHKRQKKVTSSAGSTHydrophilic
NLS Segment(s)
PositionSequence
27-57PPKPKAAASAPTPKEQKKHAGLKAKASKHKR
Subcellular Location(s) mito 17, nucl 10
Family & Domain DBs
Amino Acid Sequences MGRSAKFHKRQKKVTSSAGSTAVSQPPPKPKAAASAPTPKEQKKHAGLKAKASKHKREGDGPVLGGADYVELMFGSRRRAKEEAAKLPKDPES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.75
4 0.68
5 0.61
6 0.51
7 0.42
8 0.38
9 0.32
10 0.26
11 0.24
12 0.25
13 0.31
14 0.33
15 0.32
16 0.31
17 0.28
18 0.33
19 0.36
20 0.36
21 0.33
22 0.4
23 0.41
24 0.45
25 0.48
26 0.43
27 0.41
28 0.39
29 0.42
30 0.4
31 0.46
32 0.46
33 0.52
34 0.51
35 0.58
36 0.63
37 0.62
38 0.63
39 0.61
40 0.63
41 0.61
42 0.66
43 0.6
44 0.58
45 0.57
46 0.54
47 0.5
48 0.42
49 0.34
50 0.27
51 0.24
52 0.18
53 0.12
54 0.07
55 0.04
56 0.04
57 0.03
58 0.03
59 0.03
60 0.06
61 0.07
62 0.15
63 0.2
64 0.22
65 0.28
66 0.31
67 0.35
68 0.43
69 0.52
70 0.55
71 0.59
72 0.61
73 0.57