Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2I7B1

Protein Details
Accession A0A1Y2I7B1   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-38RGTSRCSSDSESRPRRRRRRGKMMPTSAAQHydrophilic
NLS Segment(s)
PositionSequence
21-30RPRRRRRRGK
Subcellular Location(s) nucl 15.5, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MTGAATLPRGTSRCSSDSESRPRRRRRRGKMMPTSAAQDTKLLWPLIHVERRRSQAACSVKGSQVVRTSSGSAARQRTRDVSAMQWNDVPSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.4
4 0.47
5 0.55
6 0.61
7 0.66
8 0.74
9 0.81
10 0.85
11 0.89
12 0.91
13 0.91
14 0.92
15 0.92
16 0.94
17 0.93
18 0.91
19 0.83
20 0.73
21 0.66
22 0.56
23 0.46
24 0.36
25 0.25
26 0.18
27 0.16
28 0.17
29 0.13
30 0.11
31 0.1
32 0.14
33 0.17
34 0.23
35 0.23
36 0.25
37 0.29
38 0.34
39 0.36
40 0.33
41 0.3
42 0.32
43 0.36
44 0.35
45 0.34
46 0.33
47 0.3
48 0.35
49 0.35
50 0.3
51 0.3
52 0.28
53 0.26
54 0.25
55 0.26
56 0.22
57 0.26
58 0.26
59 0.27
60 0.34
61 0.36
62 0.37
63 0.39
64 0.41
65 0.41
66 0.41
67 0.38
68 0.36
69 0.41
70 0.42
71 0.4
72 0.39