Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2IDT5

Protein Details
Accession A0A1Y2IDT5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-25MSAGRKVHPLKKRKLAPSVSHydrophilic
NLS Segment(s)
PositionSequence
16-17KK
Subcellular Location(s) mito 26.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036280  Multihaem_cyt_sf  
Amino Acid Sequences MGIADMSAGRKVHPLKKRKLAPSVSATMPAQPASLIPATPGIVGTPICNSCHRAFAGSKRNQLVQCARCHEPTCMICSRTCNGCPPSEPPTPALTTSPSSVPDTPLMSPRRSSVALGLDLRNLQDHAPVQTLAGRRRKVRELDQDEDRTEGRRRGRSDEEAEEEGAEEVLPGCGRTVCQKCCFETPARCAIVFVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.57
3 0.67
4 0.76
5 0.77
6 0.81
7 0.78
8 0.76
9 0.73
10 0.69
11 0.59
12 0.54
13 0.46
14 0.38
15 0.33
16 0.26
17 0.19
18 0.14
19 0.13
20 0.12
21 0.13
22 0.1
23 0.09
24 0.1
25 0.11
26 0.11
27 0.11
28 0.07
29 0.08
30 0.08
31 0.08
32 0.1
33 0.11
34 0.13
35 0.15
36 0.19
37 0.19
38 0.22
39 0.22
40 0.22
41 0.24
42 0.31
43 0.4
44 0.41
45 0.46
46 0.45
47 0.49
48 0.47
49 0.49
50 0.49
51 0.44
52 0.43
53 0.42
54 0.43
55 0.41
56 0.42
57 0.38
58 0.35
59 0.31
60 0.31
61 0.29
62 0.28
63 0.26
64 0.27
65 0.29
66 0.26
67 0.26
68 0.27
69 0.25
70 0.25
71 0.26
72 0.27
73 0.31
74 0.3
75 0.3
76 0.26
77 0.26
78 0.26
79 0.24
80 0.21
81 0.17
82 0.15
83 0.15
84 0.14
85 0.13
86 0.14
87 0.14
88 0.15
89 0.14
90 0.14
91 0.14
92 0.2
93 0.21
94 0.19
95 0.2
96 0.19
97 0.21
98 0.21
99 0.2
100 0.17
101 0.17
102 0.18
103 0.2
104 0.19
105 0.16
106 0.16
107 0.16
108 0.13
109 0.11
110 0.09
111 0.09
112 0.1
113 0.1
114 0.12
115 0.11
116 0.11
117 0.14
118 0.19
119 0.23
120 0.3
121 0.32
122 0.35
123 0.4
124 0.46
125 0.49
126 0.53
127 0.57
128 0.58
129 0.6
130 0.63
131 0.62
132 0.56
133 0.52
134 0.44
135 0.36
136 0.32
137 0.33
138 0.32
139 0.36
140 0.38
141 0.43
142 0.5
143 0.53
144 0.55
145 0.55
146 0.53
147 0.48
148 0.45
149 0.38
150 0.32
151 0.25
152 0.19
153 0.13
154 0.07
155 0.05
156 0.06
157 0.06
158 0.06
159 0.06
160 0.07
161 0.08
162 0.17
163 0.25
164 0.3
165 0.38
166 0.42
167 0.45
168 0.51
169 0.55
170 0.54
171 0.54
172 0.54
173 0.55
174 0.54
175 0.49