Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2IPE9

Protein Details
Accession A0A1Y2IPE9    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
202-221PATPTKKKPKKTTSGAGPRSHydrophilic
NLS Segment(s)
PositionSequence
35-100ERRKAEEEARKRAEEEARRKAEEEKRRAEEEKKKAEEERRRTEEARRTEEAERRRADESGPRKRKS
177-189KSGESPPRKRMKK
207-221KKKPKKTTSGAGPRS
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 7, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MSDSAMSATAKLAAVKAQLAELERLAEEERRQEEERRKAEEEARKRAEEEARRKAEEEKRRAEEEKKKAEEERRRTEEARRTEEAERRRADESGPRKRKSGHPDSEYEDEEEEEDEVEKGKGKGKETAGLLKPSFGAECRFRDGPRTSSCTNCQRRAASCLNAKGLPVPMQARVDKKSGESPPRKRMKKSAPIVVDDDDEEPATPTKKKPKKTTSGAGPRSSEKGPGAAAGVAESGGEGPGRVRLGREEKEWLGMSRLLHHLEEEGELRAEWALADSKVMRQAVRKEVGKWAEEELRPMIRAEIRSVLAEFFETPAEQEDGEGQEEGEGQEGEGEGGEEEAPAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.13
5 0.14
6 0.16
7 0.17
8 0.15
9 0.15
10 0.14
11 0.15
12 0.16
13 0.17
14 0.17
15 0.23
16 0.25
17 0.3
18 0.33
19 0.4
20 0.48
21 0.55
22 0.59
23 0.59
24 0.59
25 0.58
26 0.64
27 0.66
28 0.65
29 0.65
30 0.65
31 0.59
32 0.57
33 0.59
34 0.59
35 0.59
36 0.59
37 0.59
38 0.59
39 0.59
40 0.6
41 0.63
42 0.63
43 0.63
44 0.63
45 0.61
46 0.61
47 0.64
48 0.67
49 0.68
50 0.68
51 0.68
52 0.69
53 0.65
54 0.63
55 0.65
56 0.7
57 0.71
58 0.71
59 0.71
60 0.67
61 0.69
62 0.68
63 0.69
64 0.68
65 0.66
66 0.64
67 0.56
68 0.54
69 0.54
70 0.59
71 0.57
72 0.56
73 0.5
74 0.46
75 0.45
76 0.41
77 0.37
78 0.4
79 0.43
80 0.46
81 0.53
82 0.52
83 0.53
84 0.56
85 0.62
86 0.63
87 0.63
88 0.61
89 0.56
90 0.59
91 0.61
92 0.61
93 0.54
94 0.45
95 0.35
96 0.26
97 0.21
98 0.18
99 0.12
100 0.08
101 0.07
102 0.06
103 0.07
104 0.07
105 0.09
106 0.09
107 0.15
108 0.18
109 0.19
110 0.25
111 0.26
112 0.3
113 0.3
114 0.37
115 0.34
116 0.36
117 0.34
118 0.28
119 0.27
120 0.22
121 0.21
122 0.14
123 0.15
124 0.15
125 0.17
126 0.21
127 0.22
128 0.22
129 0.28
130 0.3
131 0.32
132 0.33
133 0.36
134 0.33
135 0.36
136 0.41
137 0.45
138 0.49
139 0.48
140 0.48
141 0.45
142 0.45
143 0.48
144 0.46
145 0.41
146 0.39
147 0.37
148 0.35
149 0.32
150 0.3
151 0.24
152 0.22
153 0.17
154 0.14
155 0.13
156 0.13
157 0.15
158 0.17
159 0.19
160 0.2
161 0.21
162 0.19
163 0.2
164 0.24
165 0.27
166 0.35
167 0.42
168 0.47
169 0.55
170 0.65
171 0.67
172 0.64
173 0.68
174 0.68
175 0.69
176 0.67
177 0.65
178 0.58
179 0.57
180 0.56
181 0.48
182 0.38
183 0.29
184 0.23
185 0.16
186 0.13
187 0.1
188 0.08
189 0.08
190 0.09
191 0.1
192 0.14
193 0.25
194 0.31
195 0.4
196 0.49
197 0.58
198 0.66
199 0.72
200 0.76
201 0.76
202 0.8
203 0.78
204 0.72
205 0.64
206 0.56
207 0.53
208 0.44
209 0.36
210 0.26
211 0.21
212 0.17
213 0.15
214 0.14
215 0.11
216 0.1
217 0.07
218 0.07
219 0.05
220 0.05
221 0.04
222 0.04
223 0.03
224 0.03
225 0.03
226 0.03
227 0.06
228 0.07
229 0.07
230 0.08
231 0.14
232 0.21
233 0.24
234 0.27
235 0.3
236 0.29
237 0.33
238 0.34
239 0.29
240 0.24
241 0.24
242 0.22
243 0.2
244 0.23
245 0.21
246 0.2
247 0.19
248 0.17
249 0.15
250 0.17
251 0.14
252 0.12
253 0.1
254 0.1
255 0.1
256 0.09
257 0.08
258 0.07
259 0.07
260 0.08
261 0.07
262 0.09
263 0.1
264 0.12
265 0.17
266 0.18
267 0.18
268 0.22
269 0.28
270 0.35
271 0.42
272 0.43
273 0.4
274 0.47
275 0.5
276 0.46
277 0.41
278 0.38
279 0.38
280 0.35
281 0.36
282 0.32
283 0.3
284 0.29
285 0.28
286 0.27
287 0.24
288 0.25
289 0.25
290 0.25
291 0.24
292 0.25
293 0.25
294 0.22
295 0.18
296 0.18
297 0.15
298 0.12
299 0.12
300 0.1
301 0.1
302 0.13
303 0.13
304 0.12
305 0.12
306 0.13
307 0.14
308 0.16
309 0.15
310 0.12
311 0.11
312 0.12
313 0.12
314 0.11
315 0.09
316 0.07
317 0.08
318 0.08
319 0.08
320 0.07
321 0.07
322 0.05
323 0.06
324 0.06