Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2IUN7

Protein Details
Accession A0A1Y2IUN7    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MARMRKRVRRAHSMPPPDRRNTQLRLRRRLRRSLGBasic
NLS Segment(s)
PositionSequence
4-32MRKRVRRAHSMPPPDRRNTQLRLRRRLRR
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MARMRKRVRRAHSMPPPDRRNTQLRLRRRLRRSLGWLHCNVPPLTLRHRETTTHGCLSRRRTFAPRSRSVWAAERPARPPPTTMTWDMMMMWRIGRVGRMGEQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.8
4 0.75
5 0.73
6 0.67
7 0.64
8 0.59
9 0.61
10 0.6
11 0.63
12 0.68
13 0.74
14 0.78
15 0.77
16 0.81
17 0.77
18 0.76
19 0.74
20 0.74
21 0.73
22 0.69
23 0.65
24 0.57
25 0.52
26 0.47
27 0.39
28 0.3
29 0.24
30 0.2
31 0.24
32 0.28
33 0.29
34 0.29
35 0.31
36 0.31
37 0.34
38 0.37
39 0.35
40 0.32
41 0.32
42 0.31
43 0.33
44 0.4
45 0.42
46 0.39
47 0.38
48 0.4
49 0.47
50 0.53
51 0.57
52 0.56
53 0.53
54 0.54
55 0.52
56 0.49
57 0.47
58 0.43
59 0.43
60 0.42
61 0.41
62 0.41
63 0.47
64 0.48
65 0.42
66 0.4
67 0.36
68 0.37
69 0.38
70 0.39
71 0.34
72 0.31
73 0.31
74 0.29
75 0.27
76 0.22
77 0.17
78 0.14
79 0.12
80 0.12
81 0.12
82 0.13
83 0.12
84 0.14