Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2J4B1

Protein Details
Accession A0A1Y2J4B1   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
191-221GSEGQPAKRPRGRPKGSKNSKTKTKPSSTPAHydrophilic
NLS Segment(s)
PositionSequence
196-215PAKRPRGRPKGSKNSKTKTK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MASTSAGSSAQPSASSATAAPTGPLLAQGDWTKSLIQLAKTAELKWVHAHLDRDHTLHTAHILSAHAALEQKNKAIQDLKEQKNKLESERQRLLNCLREVNEDRDKADIQEATLNKEVSELQHKIKSISEGDYAAAKNDVDRLRQELGQPPLPSLQTTLEEKSAEYLKALRLQAEAANATSGTKRAGDDLGSEGQPAKRPRGRPKGSKNSKTKTKPSSTPAPTANAAASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.12
4 0.13
5 0.14
6 0.14
7 0.13
8 0.11
9 0.11
10 0.1
11 0.11
12 0.11
13 0.09
14 0.13
15 0.14
16 0.16
17 0.17
18 0.18
19 0.16
20 0.15
21 0.19
22 0.19
23 0.18
24 0.2
25 0.21
26 0.26
27 0.27
28 0.27
29 0.28
30 0.26
31 0.27
32 0.25
33 0.25
34 0.22
35 0.25
36 0.28
37 0.25
38 0.31
39 0.31
40 0.3
41 0.29
42 0.26
43 0.23
44 0.2
45 0.19
46 0.12
47 0.11
48 0.11
49 0.1
50 0.09
51 0.1
52 0.1
53 0.09
54 0.09
55 0.1
56 0.14
57 0.14
58 0.15
59 0.16
60 0.16
61 0.18
62 0.21
63 0.21
64 0.27
65 0.37
66 0.43
67 0.48
68 0.49
69 0.49
70 0.5
71 0.51
72 0.45
73 0.45
74 0.44
75 0.45
76 0.51
77 0.53
78 0.47
79 0.49
80 0.48
81 0.45
82 0.41
83 0.34
84 0.28
85 0.3
86 0.32
87 0.35
88 0.37
89 0.3
90 0.29
91 0.29
92 0.28
93 0.23
94 0.22
95 0.16
96 0.1
97 0.15
98 0.14
99 0.16
100 0.18
101 0.17
102 0.15
103 0.15
104 0.15
105 0.12
106 0.17
107 0.16
108 0.16
109 0.19
110 0.19
111 0.19
112 0.2
113 0.21
114 0.17
115 0.17
116 0.16
117 0.14
118 0.14
119 0.15
120 0.14
121 0.12
122 0.11
123 0.09
124 0.08
125 0.13
126 0.14
127 0.13
128 0.14
129 0.17
130 0.19
131 0.2
132 0.22
133 0.23
134 0.26
135 0.3
136 0.29
137 0.26
138 0.27
139 0.26
140 0.24
141 0.19
142 0.16
143 0.14
144 0.17
145 0.17
146 0.17
147 0.17
148 0.17
149 0.18
150 0.18
151 0.15
152 0.13
153 0.13
154 0.14
155 0.2
156 0.2
157 0.18
158 0.17
159 0.18
160 0.19
161 0.19
162 0.18
163 0.12
164 0.12
165 0.11
166 0.12
167 0.11
168 0.1
169 0.09
170 0.1
171 0.1
172 0.11
173 0.12
174 0.12
175 0.13
176 0.16
177 0.18
178 0.17
179 0.17
180 0.17
181 0.18
182 0.25
183 0.26
184 0.31
185 0.35
186 0.43
187 0.54
188 0.63
189 0.7
190 0.74
191 0.82
192 0.85
193 0.9
194 0.91
195 0.91
196 0.9
197 0.91
198 0.9
199 0.88
200 0.87
201 0.85
202 0.82
203 0.79
204 0.8
205 0.75
206 0.73
207 0.67
208 0.62
209 0.54
210 0.48