Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2IPV2

Protein Details
Accession A0A1Y2IPV2    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-28FAARRPSSRPRSRTAHRRCRCQVDTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 11, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR024655  Asl1_glyco_hydro_catalytic  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF11790  Glyco_hydro_cc  
Amino Acid Sequences MQLFAARRPSSRPRSRTAHRRCRCQVDTIAAHIYDSATNVAYYQKYIADLGTRYNRSMVPFLDNLDSVLRYAWFMTAVDNLVNSDASLSALGETYVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.75
3 0.79
4 0.8
5 0.81
6 0.78
7 0.83
8 0.83
9 0.84
10 0.76
11 0.71
12 0.64
13 0.61
14 0.55
15 0.48
16 0.43
17 0.33
18 0.3
19 0.24
20 0.2
21 0.12
22 0.1
23 0.08
24 0.06
25 0.06
26 0.06
27 0.08
28 0.07
29 0.08
30 0.08
31 0.07
32 0.07
33 0.08
34 0.08
35 0.07
36 0.08
37 0.11
38 0.16
39 0.17
40 0.17
41 0.18
42 0.19
43 0.19
44 0.21
45 0.18
46 0.16
47 0.16
48 0.17
49 0.17
50 0.16
51 0.15
52 0.14
53 0.13
54 0.09
55 0.09
56 0.08
57 0.07
58 0.07
59 0.07
60 0.07
61 0.06
62 0.08
63 0.08
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.09
70 0.07
71 0.07
72 0.06
73 0.07
74 0.07
75 0.06
76 0.06
77 0.06