Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9NK58

Protein Details
Accession G9NK58    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-35SLCCGKAKPLKAPKKQNKDLDDHydrophilic
NLS Segment(s)
PositionSequence
43-77KKKADEKARKDLVAKAGGRGPLNTGTQGIKKSGKK
Subcellular Location(s) extr 14, cyto 7, nucl 2, mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences VVLTEKVILFLSSSLCCGKAKPLKAPKKQNKDLDDDDLAYLEKKKADEKARKDLVAKAGGRGPLNTGTQGIKKSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.13
5 0.21
6 0.26
7 0.29
8 0.37
9 0.47
10 0.56
11 0.66
12 0.76
13 0.78
14 0.81
15 0.86
16 0.84
17 0.78
18 0.75
19 0.68
20 0.62
21 0.53
22 0.43
23 0.34
24 0.26
25 0.22
26 0.15
27 0.13
28 0.09
29 0.09
30 0.09
31 0.11
32 0.18
33 0.27
34 0.36
35 0.41
36 0.51
37 0.54
38 0.55
39 0.55
40 0.52
41 0.48
42 0.47
43 0.41
44 0.33
45 0.32
46 0.33
47 0.32
48 0.28
49 0.25
50 0.22
51 0.23
52 0.21
53 0.2
54 0.2
55 0.23
56 0.25
57 0.27