Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2IPP7

Protein Details
Accession A0A1Y2IPP7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
71-90HDRGDRDRRHRDDHRDRDREBasic
NLS Segment(s)
PositionSequence
76-123RDRRHRDDHRDRDRERDRERYESRRHSERDGGHRDPRDRDRERYGRGR
130-181ARRHRDDDRRRERRGGDDEQPHGHRRPPRDDDRGERRGRGRNREMGTPERRS
Subcellular Location(s) mito 9, nucl 8.5, cyto_nucl 7, cyto 4.5, extr 3
Family & Domain DBs
Amino Acid Sequences MPFRTPIPTAPHRPPQCLCAAVKEIMPVIAGIPPRLYVLTESGLLAASAFTHAALSPAERYGDRHHSSRDHDRGDRDRRHRDDHRDRDRERDRERYESRRHSERDGGHRDPRDRDRERYGRGREDYEEYARRHRDDDRRRERRGGDDEQPHGHRRPPRDDDRGERRGRGRNREMGTPERRSPTPPDAVPLSQRKRKASGWDVHAPGYEQYTAMQAKQTGECDDPLVTLRLSLFKPAFVVAHSLACITMDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.58
3 0.54
4 0.52
5 0.45
6 0.41
7 0.41
8 0.35
9 0.34
10 0.31
11 0.26
12 0.21
13 0.2
14 0.13
15 0.1
16 0.11
17 0.11
18 0.1
19 0.1
20 0.11
21 0.11
22 0.12
23 0.12
24 0.1
25 0.12
26 0.13
27 0.13
28 0.13
29 0.12
30 0.12
31 0.11
32 0.09
33 0.06
34 0.05
35 0.05
36 0.05
37 0.04
38 0.05
39 0.05
40 0.06
41 0.06
42 0.07
43 0.08
44 0.09
45 0.1
46 0.1
47 0.13
48 0.18
49 0.27
50 0.29
51 0.31
52 0.34
53 0.38
54 0.44
55 0.51
56 0.53
57 0.49
58 0.5
59 0.54
60 0.59
61 0.65
62 0.68
63 0.66
64 0.69
65 0.68
66 0.73
67 0.74
68 0.76
69 0.77
70 0.78
71 0.81
72 0.8
73 0.76
74 0.78
75 0.78
76 0.76
77 0.7
78 0.7
79 0.63
80 0.63
81 0.68
82 0.66
83 0.67
84 0.67
85 0.67
86 0.65
87 0.64
88 0.58
89 0.59
90 0.56
91 0.56
92 0.55
93 0.53
94 0.51
95 0.53
96 0.53
97 0.52
98 0.52
99 0.52
100 0.49
101 0.49
102 0.52
103 0.53
104 0.56
105 0.59
106 0.57
107 0.54
108 0.52
109 0.49
110 0.42
111 0.4
112 0.37
113 0.32
114 0.34
115 0.28
116 0.33
117 0.32
118 0.31
119 0.29
120 0.34
121 0.4
122 0.44
123 0.54
124 0.59
125 0.66
126 0.69
127 0.72
128 0.67
129 0.65
130 0.61
131 0.56
132 0.52
133 0.49
134 0.48
135 0.47
136 0.48
137 0.44
138 0.38
139 0.38
140 0.35
141 0.35
142 0.41
143 0.45
144 0.5
145 0.54
146 0.58
147 0.62
148 0.66
149 0.69
150 0.63
151 0.6
152 0.57
153 0.58
154 0.61
155 0.62
156 0.59
157 0.59
158 0.59
159 0.6
160 0.6
161 0.59
162 0.59
163 0.56
164 0.53
165 0.49
166 0.48
167 0.45
168 0.47
169 0.44
170 0.43
171 0.37
172 0.36
173 0.35
174 0.36
175 0.4
176 0.44
177 0.45
178 0.45
179 0.5
180 0.51
181 0.52
182 0.55
183 0.57
184 0.56
185 0.56
186 0.58
187 0.6
188 0.58
189 0.54
190 0.5
191 0.42
192 0.33
193 0.28
194 0.21
195 0.13
196 0.11
197 0.15
198 0.15
199 0.15
200 0.17
201 0.16
202 0.19
203 0.21
204 0.23
205 0.21
206 0.22
207 0.22
208 0.22
209 0.2
210 0.18
211 0.17
212 0.17
213 0.14
214 0.13
215 0.13
216 0.16
217 0.16
218 0.22
219 0.21
220 0.2
221 0.21
222 0.21
223 0.21
224 0.17
225 0.22
226 0.16
227 0.17
228 0.17
229 0.16
230 0.14