Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2IHA3

Protein Details
Accession A0A1Y2IHA3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
88-123SEDGVKLRVRKRKEKRKGKRKGRRQRLEKEWRRAEMBasic
NLS Segment(s)
PositionSequence
93-141KLRVRKRKEKRKGKRKGRRQRLEKEWRRAEMGRRSVKGQAELQPRAKLR
Subcellular Location(s) nucl 13.5, cyto_nucl 10, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MLGTVWAVELVGGLSSDELLLRLMVEVQGLRLDLKKLSELALGVVDLRDRNTTLEEYYWALLDGLEMDEGSAEGSGSEFVGSESAVESEDGVKLRVRKRKEKRKGKRKGRRQRLEKEWRRAEMGRRSVKGQAELQPRAKLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.05
11 0.05
12 0.06
13 0.06
14 0.06
15 0.07
16 0.07
17 0.08
18 0.09
19 0.1
20 0.1
21 0.12
22 0.13
23 0.12
24 0.13
25 0.13
26 0.12
27 0.11
28 0.1
29 0.09
30 0.08
31 0.07
32 0.07
33 0.06
34 0.07
35 0.07
36 0.08
37 0.09
38 0.1
39 0.11
40 0.12
41 0.12
42 0.12
43 0.12
44 0.12
45 0.11
46 0.09
47 0.08
48 0.07
49 0.06
50 0.05
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.02
60 0.02
61 0.02
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.06
77 0.07
78 0.07
79 0.09
80 0.14
81 0.21
82 0.28
83 0.34
84 0.44
85 0.55
86 0.65
87 0.74
88 0.81
89 0.86
90 0.9
91 0.94
92 0.95
93 0.95
94 0.95
95 0.95
96 0.95
97 0.95
98 0.94
99 0.93
100 0.93
101 0.93
102 0.92
103 0.91
104 0.88
105 0.8
106 0.76
107 0.7
108 0.68
109 0.67
110 0.66
111 0.64
112 0.59
113 0.59
114 0.59
115 0.58
116 0.54
117 0.49
118 0.48
119 0.48
120 0.53
121 0.55