Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2I5E9

Protein Details
Accession A0A1Y2I5E9   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
287-312TTRSNNLKTHKNEKHLRLRPFRCPVEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
Amino Acid Sequences MNEEYESFFHDPLFQSICQDGGLTKQIVTPDHRVDRHPLSHGALPVGDVQDFEHDVDASLAGVNSIDPRLIFPPSQYLSSALFANTPRDDDAATSSSLSAWNCSEGTSPPTSPEYLPSEDVQGGLKANERNPPPSSPAPELSLNEDDLMKLIGMLSDSTSPGASLHHKDGTPLHDFVERDVSAPSYSSPPPESHEHSSPRHPGAAVAAAYGSGDGMRVHPTNTVAVDSRTGWNGAASSRGDTLTDAGALAPASGVVRRKATAEASSRRQSSEKRTLFCDEPGCSYFTTRSNNLKTHKNEKHLRLRPFRCPVEGCPKSRDGYCRNSEMRKHVAKKHPEYMPPAHEPGPSIPTFGGHYTPAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.22
4 0.22
5 0.19
6 0.17
7 0.14
8 0.14
9 0.18
10 0.16
11 0.16
12 0.18
13 0.2
14 0.23
15 0.28
16 0.31
17 0.35
18 0.42
19 0.44
20 0.45
21 0.49
22 0.53
23 0.53
24 0.5
25 0.45
26 0.41
27 0.43
28 0.41
29 0.35
30 0.28
31 0.24
32 0.22
33 0.2
34 0.16
35 0.12
36 0.11
37 0.13
38 0.14
39 0.13
40 0.11
41 0.1
42 0.11
43 0.11
44 0.1
45 0.08
46 0.07
47 0.06
48 0.05
49 0.05
50 0.05
51 0.06
52 0.06
53 0.06
54 0.06
55 0.08
56 0.1
57 0.13
58 0.13
59 0.13
60 0.2
61 0.22
62 0.23
63 0.22
64 0.22
65 0.22
66 0.23
67 0.22
68 0.15
69 0.16
70 0.15
71 0.19
72 0.17
73 0.16
74 0.16
75 0.16
76 0.16
77 0.14
78 0.17
79 0.14
80 0.14
81 0.13
82 0.12
83 0.12
84 0.14
85 0.13
86 0.11
87 0.1
88 0.11
89 0.11
90 0.11
91 0.12
92 0.11
93 0.16
94 0.17
95 0.17
96 0.17
97 0.19
98 0.2
99 0.19
100 0.21
101 0.22
102 0.21
103 0.23
104 0.21
105 0.22
106 0.2
107 0.2
108 0.17
109 0.13
110 0.11
111 0.1
112 0.13
113 0.13
114 0.15
115 0.2
116 0.21
117 0.25
118 0.27
119 0.29
120 0.31
121 0.32
122 0.35
123 0.33
124 0.33
125 0.32
126 0.31
127 0.3
128 0.28
129 0.26
130 0.21
131 0.18
132 0.16
133 0.13
134 0.11
135 0.1
136 0.06
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.05
143 0.05
144 0.05
145 0.06
146 0.06
147 0.05
148 0.05
149 0.07
150 0.09
151 0.11
152 0.13
153 0.15
154 0.16
155 0.17
156 0.19
157 0.21
158 0.21
159 0.19
160 0.18
161 0.18
162 0.19
163 0.18
164 0.22
165 0.18
166 0.15
167 0.15
168 0.15
169 0.11
170 0.12
171 0.12
172 0.1
173 0.1
174 0.11
175 0.12
176 0.12
177 0.16
178 0.19
179 0.24
180 0.25
181 0.3
182 0.33
183 0.34
184 0.39
185 0.4
186 0.37
187 0.33
188 0.28
189 0.23
190 0.2
191 0.2
192 0.15
193 0.11
194 0.09
195 0.08
196 0.08
197 0.07
198 0.06
199 0.02
200 0.03
201 0.03
202 0.04
203 0.07
204 0.08
205 0.08
206 0.1
207 0.11
208 0.11
209 0.12
210 0.12
211 0.1
212 0.11
213 0.12
214 0.12
215 0.12
216 0.12
217 0.12
218 0.11
219 0.1
220 0.1
221 0.09
222 0.11
223 0.1
224 0.1
225 0.11
226 0.11
227 0.11
228 0.11
229 0.11
230 0.09
231 0.08
232 0.07
233 0.06
234 0.06
235 0.06
236 0.05
237 0.04
238 0.04
239 0.04
240 0.06
241 0.08
242 0.1
243 0.12
244 0.12
245 0.14
246 0.16
247 0.19
248 0.23
249 0.29
250 0.34
251 0.39
252 0.45
253 0.45
254 0.45
255 0.46
256 0.45
257 0.47
258 0.51
259 0.5
260 0.46
261 0.49
262 0.52
263 0.5
264 0.49
265 0.45
266 0.35
267 0.34
268 0.33
269 0.3
270 0.26
271 0.25
272 0.24
273 0.24
274 0.28
275 0.29
276 0.37
277 0.41
278 0.47
279 0.5
280 0.57
281 0.59
282 0.64
283 0.66
284 0.67
285 0.71
286 0.74
287 0.8
288 0.79
289 0.82
290 0.82
291 0.81
292 0.81
293 0.81
294 0.75
295 0.7
296 0.65
297 0.63
298 0.63
299 0.64
300 0.58
301 0.54
302 0.54
303 0.51
304 0.51
305 0.52
306 0.48
307 0.5
308 0.52
309 0.55
310 0.58
311 0.63
312 0.64
313 0.63
314 0.66
315 0.67
316 0.68
317 0.7
318 0.74
319 0.76
320 0.78
321 0.8
322 0.78
323 0.74
324 0.74
325 0.72
326 0.69
327 0.64
328 0.6
329 0.54
330 0.47
331 0.44
332 0.4
333 0.39
334 0.32
335 0.28
336 0.24
337 0.23
338 0.25
339 0.24
340 0.22