Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2J548

Protein Details
Accession A0A1Y2J548    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-48PVEPRRSSRIKEQPKPEPAPKKAPAKPRSKKAKEPAAEBasic
NLS Segment(s)
PositionSequence
14-69PRRSSRIKEQPKPEPAPKKAPAKPRSKKAKEPAAEGEEKPKSTKGRKRTAAEKDEE
71-154GAPAANGEEPPAKKAKPASKAGSKPASKAAGTTSKPASKASRAGSKPPSRASAKPASRASAKPPSSAGKKPASRAGSKKPASKV
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MPRKAAQPAEPVEPRRSSRIKEQPKPEPAPKKAPAKPRSKKAKEPAAEGEEKPKSTKGRKRTAAEKDEEDGAPAANGEEPPAKKAKPASKAGSKPASKAAGTTSKPASKASRAGSKPPSRASAKPASRASAKPPSSAGKKPASRAGSKKPASKVGAAEKENGAAPAQETIAEEPEAEAAAEAASKDQPAQEKAGDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.53
4 0.49
5 0.54
6 0.6
7 0.65
8 0.69
9 0.75
10 0.76
11 0.8
12 0.84
13 0.83
14 0.82
15 0.78
16 0.78
17 0.76
18 0.76
19 0.73
20 0.76
21 0.75
22 0.76
23 0.79
24 0.8
25 0.84
26 0.82
27 0.85
28 0.84
29 0.85
30 0.77
31 0.74
32 0.71
33 0.66
34 0.62
35 0.53
36 0.52
37 0.44
38 0.42
39 0.37
40 0.34
41 0.35
42 0.41
43 0.48
44 0.49
45 0.57
46 0.64
47 0.68
48 0.73
49 0.76
50 0.74
51 0.7
52 0.63
53 0.54
54 0.49
55 0.43
56 0.34
57 0.24
58 0.17
59 0.12
60 0.09
61 0.07
62 0.05
63 0.05
64 0.06
65 0.09
66 0.1
67 0.12
68 0.15
69 0.14
70 0.16
71 0.22
72 0.28
73 0.31
74 0.37
75 0.41
76 0.47
77 0.5
78 0.54
79 0.56
80 0.49
81 0.44
82 0.42
83 0.38
84 0.3
85 0.27
86 0.24
87 0.23
88 0.24
89 0.25
90 0.24
91 0.24
92 0.25
93 0.27
94 0.26
95 0.21
96 0.25
97 0.26
98 0.32
99 0.32
100 0.37
101 0.44
102 0.47
103 0.48
104 0.46
105 0.48
106 0.43
107 0.44
108 0.44
109 0.45
110 0.43
111 0.46
112 0.45
113 0.43
114 0.43
115 0.42
116 0.42
117 0.42
118 0.4
119 0.34
120 0.35
121 0.38
122 0.4
123 0.42
124 0.42
125 0.41
126 0.43
127 0.45
128 0.5
129 0.48
130 0.49
131 0.52
132 0.55
133 0.57
134 0.58
135 0.62
136 0.58
137 0.61
138 0.57
139 0.54
140 0.5
141 0.49
142 0.52
143 0.47
144 0.46
145 0.38
146 0.37
147 0.34
148 0.29
149 0.2
150 0.12
151 0.11
152 0.1
153 0.09
154 0.09
155 0.1
156 0.1
157 0.12
158 0.12
159 0.11
160 0.1
161 0.1
162 0.1
163 0.08
164 0.07
165 0.05
166 0.05
167 0.05
168 0.05
169 0.06
170 0.07
171 0.07
172 0.08
173 0.11
174 0.17
175 0.19
176 0.23