Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NHC3

Protein Details
Accession G9NHC3   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
60-79ILTSKWRKKRFEKYACEIRKHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 6, cyto 5.5, cyto_nucl 5.5, mito 5, nucl 4.5, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003545  Telomerase_RT  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0003721  F:telomerase RNA reverse transcriptase activity  
Amino Acid Sequences MFFDTEHNSLDTVISSLHGAFSETALKMWAYIRCLSASTRLSATLIINTIKKVVDIAFLILTSKWRKKRFEKYACEIRKAQVIATGYSAFLDVLHRRQTGYGEVIAWLREETTRLATTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.08
5 0.07
6 0.08
7 0.07
8 0.08
9 0.11
10 0.11
11 0.11
12 0.11
13 0.11
14 0.11
15 0.13
16 0.15
17 0.14
18 0.16
19 0.17
20 0.16
21 0.18
22 0.18
23 0.21
24 0.2
25 0.19
26 0.18
27 0.17
28 0.17
29 0.17
30 0.16
31 0.11
32 0.11
33 0.11
34 0.11
35 0.1
36 0.11
37 0.1
38 0.09
39 0.09
40 0.08
41 0.07
42 0.07
43 0.08
44 0.07
45 0.07
46 0.07
47 0.06
48 0.09
49 0.12
50 0.18
51 0.25
52 0.31
53 0.38
54 0.47
55 0.58
56 0.66
57 0.72
58 0.74
59 0.75
60 0.8
61 0.77
62 0.72
63 0.63
64 0.53
65 0.48
66 0.4
67 0.32
68 0.26
69 0.23
70 0.19
71 0.2
72 0.19
73 0.13
74 0.13
75 0.13
76 0.09
77 0.08
78 0.11
79 0.11
80 0.15
81 0.2
82 0.2
83 0.2
84 0.22
85 0.23
86 0.23
87 0.24
88 0.21
89 0.16
90 0.18
91 0.18
92 0.17
93 0.16
94 0.12
95 0.1
96 0.1
97 0.11
98 0.12
99 0.16