Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2J257

Protein Details
Accession A0A1Y2J257    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
160-183LGSYHPSRRDKDKKDKDKDADGKHBasic
NLS Segment(s)
PositionSequence
167-186RRDKDKKDKDKDADGKHGKP
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR038986  Clr2  
IPR031915  Clr2_N  
Gene Ontology GO:0070824  C:SHREC complex  
GO:0031507  P:heterochromatin formation  
Pfam View protein in Pfam  
PF16761  Clr2_transil  
Amino Acid Sequences MFIVLPTDRRVSDADPGRAPTQRFPARDEQGLVNYYEEADELMERKWREKLGIYLYHHVVKPEMERRGIKPPSKPDKVYLANFPANYTLWVHKKGDPHDPRKDHYLYGSRWVAQFRSPMEFCLHLKWLLEGQPMKRSARPDCRCCYCDGSLSQGEISSALGSYHPSRRDKDKKDKDKDADGKHGKPKTTRNEMVSTNIPFKDYTKLNQAST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.41
4 0.43
5 0.44
6 0.44
7 0.41
8 0.43
9 0.45
10 0.43
11 0.45
12 0.52
13 0.52
14 0.53
15 0.5
16 0.43
17 0.4
18 0.39
19 0.34
20 0.26
21 0.21
22 0.18
23 0.15
24 0.12
25 0.08
26 0.07
27 0.07
28 0.07
29 0.08
30 0.13
31 0.14
32 0.16
33 0.2
34 0.2
35 0.22
36 0.25
37 0.3
38 0.32
39 0.4
40 0.41
41 0.42
42 0.44
43 0.45
44 0.42
45 0.36
46 0.29
47 0.23
48 0.25
49 0.27
50 0.28
51 0.29
52 0.31
53 0.34
54 0.43
55 0.48
56 0.46
57 0.46
58 0.53
59 0.58
60 0.61
61 0.6
62 0.54
63 0.55
64 0.57
65 0.52
66 0.47
67 0.42
68 0.39
69 0.37
70 0.34
71 0.27
72 0.22
73 0.2
74 0.17
75 0.16
76 0.16
77 0.19
78 0.21
79 0.23
80 0.27
81 0.29
82 0.38
83 0.42
84 0.47
85 0.53
86 0.54
87 0.53
88 0.54
89 0.53
90 0.42
91 0.38
92 0.37
93 0.29
94 0.32
95 0.3
96 0.25
97 0.25
98 0.26
99 0.22
100 0.17
101 0.19
102 0.15
103 0.19
104 0.18
105 0.18
106 0.19
107 0.21
108 0.2
109 0.2
110 0.2
111 0.15
112 0.15
113 0.15
114 0.14
115 0.14
116 0.18
117 0.17
118 0.18
119 0.23
120 0.26
121 0.27
122 0.28
123 0.3
124 0.34
125 0.43
126 0.49
127 0.5
128 0.55
129 0.6
130 0.59
131 0.58
132 0.56
133 0.46
134 0.42
135 0.36
136 0.35
137 0.3
138 0.29
139 0.25
140 0.2
141 0.18
142 0.14
143 0.13
144 0.07
145 0.06
146 0.05
147 0.05
148 0.08
149 0.11
150 0.17
151 0.23
152 0.26
153 0.3
154 0.41
155 0.51
156 0.59
157 0.67
158 0.72
159 0.77
160 0.83
161 0.9
162 0.85
163 0.86
164 0.85
165 0.8
166 0.8
167 0.76
168 0.73
169 0.72
170 0.71
171 0.65
172 0.62
173 0.65
174 0.64
175 0.67
176 0.67
177 0.63
178 0.64
179 0.62
180 0.6
181 0.57
182 0.52
183 0.47
184 0.41
185 0.37
186 0.32
187 0.31
188 0.33
189 0.3
190 0.31
191 0.35