Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2IY54

Protein Details
Accession A0A1Y2IY54    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPGRVKKRSPLKAPERPYIAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 8.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043129  ATPase_NBD  
IPR000905  Gcp-like_dom  
IPR017861  KAE1/TsaD  
IPR034680  Kae1_archaea_euk  
IPR017860  Peptidase_M22_CS  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0000408  C:EKC/KEOPS complex  
GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0061711  F:N(6)-L-threonylcarbamoyladenine synthase activity  
GO:0008233  F:peptidase activity  
GO:0006508  P:proteolysis  
GO:0002949  P:tRNA threonylcarbamoyladenosine modification  
Pfam View protein in Pfam  
PF00814  TsaD  
PROSITE View protein in PROSITE  
PS01016  GLYCOPROTEASE  
Amino Acid Sequences MPGRVKKRSPLKAPERPYIAIGLEGSANKLGVGIIKHSPDGSVDVLSNVRHTYITPPGEGFLPRDTAQHHREWALTIINDAVSKAGVSLHDVDCICFTKGPGMGAPLVSVALVARTLSLLYNKPLVGVNHCVGHIEMGREITGAQNPVVLYVSGGNTQVIAYSQQCYRIFGETLDIAVGNCLDRFARVINLSNDPSPGYNIEQEAKKGKRLLPLPYTTKGMDISLSGILTSTEAYTTDKRFRPNGPSAEDGEDIITPQDLCFSLQEHVFAMLVEITERAMAHIGSKEVLIVGGVGCNERLQEMMGVMASERGGKVFATDERYCIDNGIMIAQAGLLSYRMGYETPLAKSTCTQRFRTDQVHVAWRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.79
3 0.7
4 0.62
5 0.55
6 0.44
7 0.36
8 0.29
9 0.21
10 0.18
11 0.16
12 0.16
13 0.13
14 0.12
15 0.1
16 0.1
17 0.09
18 0.1
19 0.11
20 0.13
21 0.16
22 0.18
23 0.19
24 0.19
25 0.19
26 0.17
27 0.19
28 0.17
29 0.14
30 0.13
31 0.14
32 0.16
33 0.16
34 0.16
35 0.14
36 0.13
37 0.12
38 0.12
39 0.15
40 0.22
41 0.24
42 0.23
43 0.23
44 0.24
45 0.25
46 0.26
47 0.23
48 0.17
49 0.19
50 0.18
51 0.19
52 0.22
53 0.27
54 0.31
55 0.32
56 0.33
57 0.31
58 0.31
59 0.31
60 0.3
61 0.26
62 0.22
63 0.18
64 0.16
65 0.15
66 0.14
67 0.13
68 0.1
69 0.07
70 0.06
71 0.06
72 0.06
73 0.06
74 0.08
75 0.12
76 0.12
77 0.16
78 0.16
79 0.16
80 0.17
81 0.19
82 0.18
83 0.14
84 0.14
85 0.14
86 0.15
87 0.16
88 0.15
89 0.14
90 0.14
91 0.14
92 0.14
93 0.1
94 0.08
95 0.07
96 0.06
97 0.04
98 0.04
99 0.04
100 0.03
101 0.03
102 0.03
103 0.04
104 0.05
105 0.08
106 0.09
107 0.11
108 0.13
109 0.13
110 0.14
111 0.16
112 0.16
113 0.17
114 0.2
115 0.2
116 0.18
117 0.18
118 0.18
119 0.15
120 0.16
121 0.14
122 0.1
123 0.1
124 0.09
125 0.09
126 0.09
127 0.09
128 0.08
129 0.09
130 0.08
131 0.08
132 0.09
133 0.08
134 0.09
135 0.09
136 0.08
137 0.07
138 0.07
139 0.08
140 0.07
141 0.07
142 0.07
143 0.06
144 0.06
145 0.06
146 0.05
147 0.06
148 0.06
149 0.08
150 0.08
151 0.14
152 0.15
153 0.17
154 0.18
155 0.18
156 0.18
157 0.16
158 0.17
159 0.11
160 0.11
161 0.09
162 0.08
163 0.06
164 0.05
165 0.05
166 0.04
167 0.03
168 0.04
169 0.03
170 0.04
171 0.04
172 0.05
173 0.07
174 0.08
175 0.11
176 0.13
177 0.17
178 0.18
179 0.17
180 0.17
181 0.16
182 0.15
183 0.12
184 0.12
185 0.1
186 0.1
187 0.11
188 0.13
189 0.14
190 0.15
191 0.22
192 0.22
193 0.24
194 0.26
195 0.28
196 0.31
197 0.34
198 0.39
199 0.38
200 0.43
201 0.44
202 0.43
203 0.43
204 0.36
205 0.34
206 0.28
207 0.22
208 0.16
209 0.11
210 0.11
211 0.08
212 0.08
213 0.07
214 0.06
215 0.06
216 0.06
217 0.06
218 0.04
219 0.04
220 0.05
221 0.08
222 0.11
223 0.14
224 0.22
225 0.24
226 0.28
227 0.32
228 0.35
229 0.4
230 0.45
231 0.47
232 0.44
233 0.44
234 0.44
235 0.43
236 0.39
237 0.32
238 0.24
239 0.19
240 0.14
241 0.12
242 0.09
243 0.06
244 0.05
245 0.07
246 0.06
247 0.07
248 0.08
249 0.09
250 0.11
251 0.11
252 0.12
253 0.11
254 0.11
255 0.1
256 0.09
257 0.08
258 0.07
259 0.06
260 0.06
261 0.05
262 0.05
263 0.05
264 0.05
265 0.05
266 0.06
267 0.06
268 0.08
269 0.09
270 0.1
271 0.09
272 0.09
273 0.09
274 0.08
275 0.08
276 0.06
277 0.05
278 0.04
279 0.05
280 0.05
281 0.06
282 0.06
283 0.06
284 0.07
285 0.07
286 0.07
287 0.07
288 0.07
289 0.07
290 0.07
291 0.07
292 0.07
293 0.07
294 0.07
295 0.07
296 0.07
297 0.07
298 0.07
299 0.07
300 0.07
301 0.08
302 0.1
303 0.14
304 0.21
305 0.21
306 0.22
307 0.24
308 0.25
309 0.24
310 0.22
311 0.19
312 0.13
313 0.13
314 0.13
315 0.11
316 0.09
317 0.09
318 0.08
319 0.08
320 0.06
321 0.06
322 0.04
323 0.04
324 0.05
325 0.05
326 0.06
327 0.06
328 0.08
329 0.12
330 0.17
331 0.19
332 0.24
333 0.24
334 0.24
335 0.29
336 0.37
337 0.42
338 0.44
339 0.45
340 0.48
341 0.55
342 0.6
343 0.63
344 0.6
345 0.58
346 0.58