Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NNC8

Protein Details
Accession G9NNC8    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-48QSALGPPPKPPKPKPRPKKRDLIKLHVATHydrophilic
171-201SDESSKPSKAPRTKKYSKSRKIEKPVQSSDSHydrophilic
NLS Segment(s)
PositionSequence
26-39PPKPPKPKPRPKKR
177-192PSKAPRTKKYSKSRKI
Subcellular Location(s) nucl 15, cyto_nucl 13.166, mito_nucl 9.832, cyto 8, cyto_mito 6.332
Family & Domain DBs
Amino Acid Sequences MPKKAGPSLLCEWMVGTSIQSALGPPPKPPKPKPRPKKRDLIKLHVATDDESGEDTLTITYPRSDRLDQSKEAPAAVPEPAAPEPEPEPEVVEVVKRVRFEKEPASAAATMPKKSAMKKKTLVTFCEEEETSDSGGDAASTSASSGEATPEASSSNESSAADTSSGGETSSDESSKPSKAPRTKKYSKSRKIEKPVQSSDSEADS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.18
3 0.14
4 0.09
5 0.08
6 0.09
7 0.08
8 0.08
9 0.12
10 0.18
11 0.18
12 0.22
13 0.31
14 0.39
15 0.48
16 0.57
17 0.64
18 0.68
19 0.79
20 0.86
21 0.88
22 0.91
23 0.9
24 0.92
25 0.9
26 0.89
27 0.87
28 0.85
29 0.83
30 0.77
31 0.71
32 0.62
33 0.53
34 0.43
35 0.35
36 0.27
37 0.17
38 0.12
39 0.11
40 0.09
41 0.08
42 0.07
43 0.06
44 0.06
45 0.06
46 0.06
47 0.08
48 0.08
49 0.11
50 0.16
51 0.17
52 0.21
53 0.29
54 0.34
55 0.33
56 0.37
57 0.39
58 0.35
59 0.33
60 0.29
61 0.21
62 0.17
63 0.16
64 0.12
65 0.07
66 0.09
67 0.09
68 0.1
69 0.1
70 0.1
71 0.11
72 0.12
73 0.13
74 0.1
75 0.11
76 0.1
77 0.1
78 0.08
79 0.08
80 0.08
81 0.09
82 0.11
83 0.11
84 0.12
85 0.14
86 0.16
87 0.18
88 0.22
89 0.23
90 0.23
91 0.22
92 0.24
93 0.21
94 0.2
95 0.23
96 0.2
97 0.17
98 0.16
99 0.18
100 0.18
101 0.23
102 0.32
103 0.3
104 0.35
105 0.4
106 0.45
107 0.51
108 0.52
109 0.5
110 0.46
111 0.44
112 0.37
113 0.35
114 0.3
115 0.22
116 0.21
117 0.2
118 0.15
119 0.13
120 0.12
121 0.08
122 0.08
123 0.07
124 0.05
125 0.04
126 0.03
127 0.03
128 0.04
129 0.04
130 0.04
131 0.05
132 0.05
133 0.06
134 0.06
135 0.07
136 0.07
137 0.07
138 0.07
139 0.07
140 0.09
141 0.09
142 0.1
143 0.1
144 0.11
145 0.12
146 0.12
147 0.12
148 0.1
149 0.1
150 0.1
151 0.1
152 0.1
153 0.09
154 0.08
155 0.08
156 0.1
157 0.12
158 0.12
159 0.11
160 0.14
161 0.17
162 0.19
163 0.21
164 0.26
165 0.34
166 0.43
167 0.53
168 0.6
169 0.68
170 0.76
171 0.83
172 0.87
173 0.89
174 0.89
175 0.9
176 0.9
177 0.91
178 0.91
179 0.91
180 0.9
181 0.88
182 0.86
183 0.8
184 0.71
185 0.64