Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2J5X3

Protein Details
Accession A0A1Y2J5X3    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MVNIPKTRRTYCKGKQCRKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10, nucl 5, mito 5, plas 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKGKQCRKHTPHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKYKMQLALKRCKHFELGGEKKTKGAALQFVRRLSLFMRLFADLACAVIVFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.86
4 0.91
5 0.89
6 0.9
7 0.9
8 0.89
9 0.89
10 0.89
11 0.9
12 0.86
13 0.87
14 0.87
15 0.82
16 0.77
17 0.71
18 0.62
19 0.56
20 0.53
21 0.53
22 0.52
23 0.51
24 0.51
25 0.52
26 0.55
27 0.58
28 0.59
29 0.56
30 0.56
31 0.6
32 0.62
33 0.64
34 0.62
35 0.61
36 0.61
37 0.62
38 0.53
39 0.48
40 0.44
41 0.37
42 0.39
43 0.4
44 0.38
45 0.32
46 0.38
47 0.42
48 0.5
49 0.58
50 0.6
51 0.59
52 0.62
53 0.68
54 0.68
55 0.66
56 0.62
57 0.56
58 0.53
59 0.51
60 0.46
61 0.41
62 0.37
63 0.32
64 0.27
65 0.25
66 0.25
67 0.29
68 0.34
69 0.37
70 0.41
71 0.5
72 0.57
73 0.61
74 0.59
75 0.53
76 0.48
77 0.44
78 0.42
79 0.43
80 0.43
81 0.45
82 0.48
83 0.46
84 0.44
85 0.43
86 0.37
87 0.28
88 0.24
89 0.25
90 0.28
91 0.35
92 0.4
93 0.4
94 0.41
95 0.39
96 0.37
97 0.3
98 0.32
99 0.25
100 0.23
101 0.25
102 0.24
103 0.24
104 0.23
105 0.24
106 0.14
107 0.14
108 0.11