Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2IIC9

Protein Details
Accession A0A1Y2IIC9   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
191-218SPLPVNRSAPRRKVRRPNLKRAETQLPRHydrophilic
NLS Segment(s)
PositionSequence
199-210APRRKVRRPNLK
Subcellular Location(s) mito 15, nucl 9, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MAPRPHPILKRDTSPFRTPTLPFSNCGPLFSPHVHFPPTPRIAATYPADSPTTYDRAPIAVSPNICALPRRGERTIQPTPADFDGERRGRSRHRARGCGGSGENIKGSYFHPRAYEACKPEPLNVPTATFDLPSTPPLVQDLSPSDESDETVTTPPDPKLSASIPRSIPPHFEGFPSLRRPETVDKADFGSPLPVNRSAPRRKVRRPNLKRAETQLPRQTPSFSPDLDEGCLGGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.64
3 0.59
4 0.58
5 0.52
6 0.52
7 0.51
8 0.46
9 0.4
10 0.42
11 0.47
12 0.42
13 0.43
14 0.37
15 0.3
16 0.33
17 0.34
18 0.34
19 0.28
20 0.31
21 0.32
22 0.31
23 0.32
24 0.38
25 0.37
26 0.35
27 0.31
28 0.32
29 0.3
30 0.35
31 0.33
32 0.27
33 0.24
34 0.25
35 0.25
36 0.21
37 0.22
38 0.21
39 0.22
40 0.18
41 0.18
42 0.17
43 0.17
44 0.18
45 0.17
46 0.17
47 0.16
48 0.17
49 0.16
50 0.18
51 0.18
52 0.17
53 0.17
54 0.15
55 0.2
56 0.25
57 0.29
58 0.3
59 0.32
60 0.36
61 0.43
62 0.47
63 0.43
64 0.39
65 0.34
66 0.35
67 0.33
68 0.31
69 0.22
70 0.2
71 0.24
72 0.25
73 0.26
74 0.25
75 0.28
76 0.3
77 0.41
78 0.48
79 0.49
80 0.53
81 0.58
82 0.59
83 0.63
84 0.59
85 0.53
86 0.44
87 0.38
88 0.32
89 0.26
90 0.24
91 0.16
92 0.15
93 0.11
94 0.12
95 0.17
96 0.16
97 0.17
98 0.17
99 0.19
100 0.21
101 0.25
102 0.3
103 0.25
104 0.26
105 0.29
106 0.28
107 0.29
108 0.34
109 0.3
110 0.28
111 0.25
112 0.24
113 0.21
114 0.21
115 0.19
116 0.13
117 0.12
118 0.1
119 0.1
120 0.1
121 0.11
122 0.09
123 0.09
124 0.1
125 0.11
126 0.09
127 0.1
128 0.12
129 0.14
130 0.15
131 0.15
132 0.15
133 0.14
134 0.14
135 0.13
136 0.12
137 0.09
138 0.09
139 0.09
140 0.09
141 0.11
142 0.11
143 0.12
144 0.12
145 0.11
146 0.14
147 0.16
148 0.23
149 0.23
150 0.29
151 0.29
152 0.31
153 0.33
154 0.31
155 0.32
156 0.27
157 0.29
158 0.24
159 0.24
160 0.25
161 0.25
162 0.3
163 0.32
164 0.31
165 0.27
166 0.27
167 0.32
168 0.35
169 0.39
170 0.4
171 0.36
172 0.35
173 0.38
174 0.38
175 0.33
176 0.27
177 0.24
178 0.19
179 0.19
180 0.22
181 0.22
182 0.24
183 0.29
184 0.38
185 0.41
186 0.5
187 0.58
188 0.64
189 0.72
190 0.8
191 0.85
192 0.88
193 0.89
194 0.91
195 0.92
196 0.9
197 0.86
198 0.82
199 0.82
200 0.77
201 0.77
202 0.75
203 0.7
204 0.65
205 0.6
206 0.57
207 0.49
208 0.47
209 0.41
210 0.32
211 0.3
212 0.3
213 0.3
214 0.28
215 0.25