Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2IXC4

Protein Details
Accession A0A1Y2IXC4   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
64-83LKEQERQRRLQKLKEENSKSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010591  ATP11  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0065003  P:protein-containing complex assembly  
Pfam View protein in Pfam  
PF06644  ATP11  
Amino Acid Sequences MLSRHALSLVPRSRPALRTLSSAAVRYNAGLSGPKVNYEEKYAEKLQRKAQEQGKSVEQLRMELKEQERQRRLQKLKEENSKSTGTSPETPRAAKSSPDPSPAASRPTPSVSRKDSSPVKPLSSIFNLDKILQAPHTPEQISVLWRAYHESRSGGTGRGFLCASLPVETYQKMLDVASKYPRFVIPVPRENAQVEEGSKEPAYEFYLMEWGFHGSPPEPSTSGDPFAQSKPSSNPQTSTILFTPLQEYKLRTSFATPYLVVTHYTDLAKTHGLVLLRGEITPSAAASSPNVGAGEDGGRYMLSQQDAQLLAIHVQRFYLWNEGSEERAALLKAFHETPADFKWEELLKHTNFSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.47
3 0.45
4 0.4
5 0.41
6 0.42
7 0.44
8 0.41
9 0.41
10 0.36
11 0.3
12 0.29
13 0.24
14 0.21
15 0.15
16 0.13
17 0.14
18 0.15
19 0.21
20 0.21
21 0.22
22 0.24
23 0.27
24 0.27
25 0.29
26 0.32
27 0.27
28 0.33
29 0.37
30 0.43
31 0.48
32 0.52
33 0.55
34 0.59
35 0.6
36 0.63
37 0.64
38 0.65
39 0.61
40 0.6
41 0.57
42 0.53
43 0.51
44 0.46
45 0.39
46 0.34
47 0.32
48 0.31
49 0.28
50 0.29
51 0.3
52 0.34
53 0.42
54 0.49
55 0.51
56 0.55
57 0.62
58 0.66
59 0.7
60 0.7
61 0.73
62 0.73
63 0.77
64 0.8
65 0.79
66 0.72
67 0.7
68 0.64
69 0.55
70 0.46
71 0.41
72 0.35
73 0.35
74 0.35
75 0.37
76 0.39
77 0.38
78 0.37
79 0.38
80 0.34
81 0.29
82 0.3
83 0.32
84 0.32
85 0.35
86 0.34
87 0.32
88 0.37
89 0.37
90 0.37
91 0.31
92 0.29
93 0.28
94 0.32
95 0.36
96 0.34
97 0.39
98 0.38
99 0.39
100 0.38
101 0.43
102 0.46
103 0.44
104 0.48
105 0.45
106 0.41
107 0.41
108 0.41
109 0.39
110 0.33
111 0.33
112 0.26
113 0.25
114 0.24
115 0.22
116 0.23
117 0.19
118 0.17
119 0.13
120 0.13
121 0.14
122 0.15
123 0.17
124 0.16
125 0.15
126 0.17
127 0.17
128 0.18
129 0.16
130 0.15
131 0.13
132 0.13
133 0.16
134 0.15
135 0.15
136 0.15
137 0.15
138 0.14
139 0.16
140 0.17
141 0.16
142 0.15
143 0.16
144 0.16
145 0.16
146 0.15
147 0.12
148 0.12
149 0.11
150 0.11
151 0.08
152 0.09
153 0.08
154 0.09
155 0.1
156 0.1
157 0.09
158 0.08
159 0.08
160 0.07
161 0.1
162 0.1
163 0.12
164 0.19
165 0.19
166 0.19
167 0.2
168 0.2
169 0.2
170 0.2
171 0.28
172 0.27
173 0.34
174 0.36
175 0.36
176 0.37
177 0.35
178 0.34
179 0.26
180 0.2
181 0.13
182 0.13
183 0.12
184 0.12
185 0.12
186 0.1
187 0.09
188 0.09
189 0.1
190 0.1
191 0.09
192 0.08
193 0.12
194 0.12
195 0.12
196 0.11
197 0.11
198 0.1
199 0.1
200 0.11
201 0.08
202 0.1
203 0.11
204 0.12
205 0.11
206 0.12
207 0.16
208 0.16
209 0.18
210 0.17
211 0.17
212 0.18
213 0.18
214 0.21
215 0.18
216 0.19
217 0.21
218 0.29
219 0.33
220 0.32
221 0.33
222 0.32
223 0.36
224 0.35
225 0.35
226 0.27
227 0.26
228 0.24
229 0.23
230 0.24
231 0.2
232 0.22
233 0.2
234 0.21
235 0.22
236 0.25
237 0.25
238 0.22
239 0.23
240 0.25
241 0.25
242 0.26
243 0.22
244 0.2
245 0.21
246 0.21
247 0.19
248 0.18
249 0.16
250 0.15
251 0.15
252 0.14
253 0.13
254 0.14
255 0.13
256 0.12
257 0.12
258 0.12
259 0.12
260 0.12
261 0.12
262 0.14
263 0.14
264 0.13
265 0.13
266 0.1
267 0.11
268 0.11
269 0.1
270 0.08
271 0.08
272 0.08
273 0.09
274 0.11
275 0.1
276 0.11
277 0.11
278 0.09
279 0.09
280 0.1
281 0.1
282 0.08
283 0.07
284 0.07
285 0.06
286 0.07
287 0.08
288 0.1
289 0.1
290 0.11
291 0.12
292 0.16
293 0.16
294 0.17
295 0.17
296 0.15
297 0.16
298 0.19
299 0.19
300 0.15
301 0.15
302 0.15
303 0.16
304 0.17
305 0.21
306 0.18
307 0.19
308 0.24
309 0.25
310 0.27
311 0.25
312 0.23
313 0.17
314 0.18
315 0.17
316 0.13
317 0.12
318 0.11
319 0.14
320 0.15
321 0.15
322 0.16
323 0.17
324 0.21
325 0.23
326 0.26
327 0.23
328 0.22
329 0.27
330 0.29
331 0.29
332 0.3
333 0.35
334 0.32