Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2IJL2

Protein Details
Accession A0A1Y2IJL2    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
32-51MQTARRGGKRAKKNDSNDESHydrophilic
57-76ISSKKAKTSKPPSIKKPKISHydrophilic
NLS Segment(s)
PositionSequence
36-45RRGGKRAKKN
55-79KPISSKKAKTSKPPSIKKPKISAKK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR003173  PC4_C  
IPR009044  ssDNA-bd_transcriptional_reg  
IPR045125  Sub1/Tcp4-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0003713  F:transcription coactivator activity  
GO:0060261  P:positive regulation of transcription initiation by RNA polymerase II  
Pfam View protein in Pfam  
PF02229  PC4  
Amino Acid Sequences MAKRKTAVASSDEEEYNDRSSASGDSSPERPMQTARRGGKRAKKNDSNDESEEEKPISSKKAKTSKPPSIKKPKISAKKDDGEEESMGAGDVKFGVDESGGRYVELGKKRRATVRQFKGATFVDIREFYGDENDLKPGKKGISLNREQWEALKKGSDAIDSFFNKMAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.24
4 0.19
5 0.17
6 0.13
7 0.14
8 0.14
9 0.15
10 0.15
11 0.15
12 0.18
13 0.2
14 0.22
15 0.24
16 0.23
17 0.22
18 0.25
19 0.3
20 0.34
21 0.42
22 0.47
23 0.53
24 0.57
25 0.64
26 0.68
27 0.71
28 0.73
29 0.74
30 0.76
31 0.75
32 0.8
33 0.78
34 0.75
35 0.67
36 0.61
37 0.55
38 0.46
39 0.4
40 0.3
41 0.24
42 0.19
43 0.17
44 0.19
45 0.2
46 0.24
47 0.31
48 0.4
49 0.44
50 0.53
51 0.61
52 0.66
53 0.71
54 0.76
55 0.77
56 0.79
57 0.82
58 0.78
59 0.78
60 0.77
61 0.77
62 0.75
63 0.73
64 0.68
65 0.67
66 0.61
67 0.55
68 0.47
69 0.39
70 0.34
71 0.26
72 0.19
73 0.13
74 0.11
75 0.09
76 0.06
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.05
86 0.08
87 0.09
88 0.08
89 0.09
90 0.11
91 0.17
92 0.23
93 0.27
94 0.29
95 0.33
96 0.37
97 0.44
98 0.5
99 0.54
100 0.58
101 0.62
102 0.66
103 0.63
104 0.6
105 0.59
106 0.52
107 0.45
108 0.35
109 0.28
110 0.22
111 0.21
112 0.21
113 0.17
114 0.16
115 0.13
116 0.14
117 0.14
118 0.12
119 0.13
120 0.16
121 0.17
122 0.17
123 0.18
124 0.19
125 0.18
126 0.22
127 0.27
128 0.33
129 0.4
130 0.46
131 0.53
132 0.54
133 0.55
134 0.5
135 0.49
136 0.47
137 0.39
138 0.35
139 0.31
140 0.26
141 0.28
142 0.3
143 0.28
144 0.22
145 0.22
146 0.28
147 0.27
148 0.29