Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2IDQ4

Protein Details
Accession A0A1Y2IDQ4    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
98-139AAGTSRCTTRRRDRPRRCRCRRCSRPRRRTRAPTPRTPESRRBasic
155-181PASRASPTPCKRCHRARPGRPSSSHPVHydrophilic
NLS Segment(s)
PositionSequence
107-135RRRDRPRRCRCRRCSRPRRRTRAPTPRTP
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
Amino Acid Sequences MCGAAKPRSIPPDPLAVRFTHWCSSLISTTQWALASSLQPSGPSAAASRPRPASSASSRLQAPQPQRVVAQPHARTLPPPRAGCASGARPGQNRVRLAAGTSRCTTRRRDRPRRCRCRRCSRPRRRTRAPTPRTPESRRSLRFVATPSSLSPLQPASRASPTPCKRCHRARPGRPSSSHPVYGYLAIGFVMH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.42
3 0.36
4 0.36
5 0.36
6 0.38
7 0.3
8 0.29
9 0.27
10 0.27
11 0.3
12 0.29
13 0.26
14 0.23
15 0.21
16 0.21
17 0.21
18 0.19
19 0.15
20 0.14
21 0.13
22 0.14
23 0.13
24 0.14
25 0.12
26 0.12
27 0.12
28 0.13
29 0.11
30 0.11
31 0.11
32 0.14
33 0.21
34 0.23
35 0.27
36 0.29
37 0.29
38 0.3
39 0.31
40 0.32
41 0.31
42 0.36
43 0.32
44 0.33
45 0.32
46 0.33
47 0.35
48 0.34
49 0.33
50 0.33
51 0.34
52 0.32
53 0.32
54 0.33
55 0.34
56 0.34
57 0.38
58 0.32
59 0.33
60 0.34
61 0.33
62 0.32
63 0.33
64 0.35
65 0.33
66 0.32
67 0.31
68 0.31
69 0.32
70 0.31
71 0.3
72 0.24
73 0.21
74 0.23
75 0.23
76 0.22
77 0.25
78 0.28
79 0.29
80 0.28
81 0.24
82 0.24
83 0.22
84 0.22
85 0.23
86 0.2
87 0.18
88 0.19
89 0.2
90 0.22
91 0.24
92 0.3
93 0.35
94 0.44
95 0.52
96 0.63
97 0.71
98 0.8
99 0.89
100 0.94
101 0.95
102 0.95
103 0.94
104 0.95
105 0.95
106 0.95
107 0.95
108 0.95
109 0.95
110 0.95
111 0.95
112 0.94
113 0.93
114 0.92
115 0.92
116 0.88
117 0.87
118 0.84
119 0.83
120 0.81
121 0.76
122 0.73
123 0.7
124 0.72
125 0.65
126 0.63
127 0.57
128 0.51
129 0.49
130 0.43
131 0.4
132 0.32
133 0.3
134 0.25
135 0.27
136 0.25
137 0.21
138 0.2
139 0.19
140 0.18
141 0.19
142 0.2
143 0.2
144 0.24
145 0.27
146 0.3
147 0.37
148 0.44
149 0.51
150 0.57
151 0.61
152 0.65
153 0.73
154 0.8
155 0.8
156 0.83
157 0.85
158 0.88
159 0.9
160 0.91
161 0.84
162 0.8
163 0.78
164 0.74
165 0.69
166 0.58
167 0.52
168 0.45
169 0.42
170 0.36
171 0.26
172 0.19