Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2IRX1

Protein Details
Accession A0A1Y2IRX1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-36QTYSTRSKPKERRTTKNASSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MLAFLGHRGQKPTEFFQTYSTRSKPKERRTTKNASSEGTATRSSGRGKATKSGDDDVER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.4
4 0.43
5 0.42
6 0.43
7 0.42
8 0.4
9 0.4
10 0.5
11 0.54
12 0.59
13 0.66
14 0.68
15 0.74
16 0.75
17 0.81
18 0.78
19 0.77
20 0.69
21 0.59
22 0.52
23 0.45
24 0.39
25 0.33
26 0.26
27 0.18
28 0.17
29 0.18
30 0.19
31 0.21
32 0.24
33 0.26
34 0.28
35 0.36
36 0.39
37 0.42
38 0.45
39 0.45