Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2IAH7

Protein Details
Accession A0A1Y2IAH7    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
563-597WAVKNDRPFKPSPKKPRRASSKRGHSKNGKGKYKLBasic
631-651EASGSAKRRRRDKSGESAPGTHydrophilic
NLS Segment(s)
PositionSequence
569-596RPFKPSPKKPRRASSKRGHSKNGKGKYK
637-641KRRRR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027640  Kinesin-like_fam  
IPR019821  Kinesin_motor_CS  
IPR001752  Kinesin_motor_dom  
IPR036961  Kinesin_motor_dom_sf  
IPR027417  P-loop_NTPase  
IPR019734  TPR_repeat  
Gene Ontology GO:0005874  C:microtubule  
GO:0005524  F:ATP binding  
GO:0008017  F:microtubule binding  
GO:0003777  F:microtubule motor activity  
GO:0007018  P:microtubule-based movement  
Pfam View protein in Pfam  
PF00225  Kinesin  
PROSITE View protein in PROSITE  
PS00411  KINESIN_MOTOR_1  
PS50067  KINESIN_MOTOR_2  
PS50005  TPR  
CDD cd00106  KISc  
Amino Acid Sequences MSYSRVKIAARLRPPIPGEQHDNAIRIVRSASGSAVVVDNPRDPGQTFNYPFSSCYDELSTQDEIFEQDVKPLIDLAFSGMTVTIFAYGVTSSGKTHTMQGNKQQPGIIPRAVEDIFHRTASQYSRAHLAVSYMEIYKDEVYDLLVDRETATKLPVRENEAGQVFVANLSVCPLETIDDFESAFSRANKQRSVGSTNLNSVSSRSHAILTLHITVTDPSNNLTLAGKLNLVDLAGSENNKLTGNDASRMAESAAINKSLSVLGQVVHALNQGASRIPYRNSKLTRILQDALGGNSIGLLICNLAPGTKFRQDTLNTLNFAVRTKNIQNKPVVNQQANAITIPSSSTSSTLTRAIPAPGQLIRPSGPRPSRVPRISNIASASQRASLTFSSLPPAVKVDKKVEEKPPAIPPHLTEDEINARIAKAVELEVARRLEEREKQRREEEEEAARRQSMSLQDDQASSLQSLPPGLLTPLLKHRQSQDEELKQRLEELESKFERGNKESHLADVLSPISRKKTGRAYVALARAHTQKNNLQVALELYRKAEAYVPDNVKLKERIIEIEWAVKNDRPFKPSPKKPRRASSKRGHSKNGKGKYKLAPPNDAVEEGDEDDEEEAGNSGVDKENLGGESGEASGSAKRRRRDKSGESAPGTPAEEAAACTVRRGVTERVARGGPWAALSTHVCTVAWLFDCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.58
3 0.56
4 0.53
5 0.54
6 0.5
7 0.55
8 0.51
9 0.5
10 0.43
11 0.41
12 0.34
13 0.27
14 0.25
15 0.2
16 0.19
17 0.18
18 0.18
19 0.15
20 0.15
21 0.14
22 0.15
23 0.14
24 0.15
25 0.16
26 0.16
27 0.18
28 0.19
29 0.2
30 0.2
31 0.23
32 0.27
33 0.35
34 0.36
35 0.37
36 0.4
37 0.39
38 0.39
39 0.38
40 0.39
41 0.29
42 0.29
43 0.29
44 0.27
45 0.28
46 0.31
47 0.3
48 0.23
49 0.23
50 0.2
51 0.16
52 0.16
53 0.17
54 0.13
55 0.13
56 0.16
57 0.16
58 0.16
59 0.16
60 0.14
61 0.12
62 0.12
63 0.12
64 0.1
65 0.09
66 0.09
67 0.08
68 0.08
69 0.08
70 0.08
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.08
79 0.08
80 0.1
81 0.13
82 0.13
83 0.19
84 0.24
85 0.31
86 0.36
87 0.45
88 0.53
89 0.53
90 0.54
91 0.5
92 0.47
93 0.45
94 0.44
95 0.36
96 0.27
97 0.25
98 0.28
99 0.26
100 0.24
101 0.21
102 0.23
103 0.22
104 0.23
105 0.22
106 0.18
107 0.22
108 0.25
109 0.3
110 0.25
111 0.25
112 0.28
113 0.28
114 0.28
115 0.25
116 0.22
117 0.16
118 0.16
119 0.16
120 0.12
121 0.12
122 0.12
123 0.13
124 0.12
125 0.11
126 0.1
127 0.08
128 0.08
129 0.09
130 0.1
131 0.1
132 0.09
133 0.09
134 0.1
135 0.12
136 0.12
137 0.11
138 0.12
139 0.14
140 0.16
141 0.22
142 0.25
143 0.3
144 0.32
145 0.32
146 0.36
147 0.33
148 0.32
149 0.26
150 0.23
151 0.16
152 0.13
153 0.12
154 0.07
155 0.05
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.07
162 0.07
163 0.11
164 0.11
165 0.12
166 0.12
167 0.12
168 0.12
169 0.12
170 0.14
171 0.11
172 0.18
173 0.23
174 0.28
175 0.29
176 0.3
177 0.34
178 0.37
179 0.41
180 0.37
181 0.37
182 0.35
183 0.36
184 0.36
185 0.32
186 0.27
187 0.23
188 0.21
189 0.17
190 0.16
191 0.14
192 0.13
193 0.14
194 0.15
195 0.16
196 0.17
197 0.18
198 0.16
199 0.15
200 0.15
201 0.13
202 0.14
203 0.13
204 0.11
205 0.09
206 0.1
207 0.1
208 0.1
209 0.1
210 0.1
211 0.1
212 0.1
213 0.1
214 0.09
215 0.09
216 0.08
217 0.08
218 0.06
219 0.05
220 0.07
221 0.08
222 0.08
223 0.08
224 0.09
225 0.1
226 0.11
227 0.1
228 0.09
229 0.12
230 0.14
231 0.15
232 0.16
233 0.16
234 0.16
235 0.17
236 0.15
237 0.14
238 0.12
239 0.14
240 0.14
241 0.14
242 0.13
243 0.13
244 0.13
245 0.1
246 0.1
247 0.07
248 0.06
249 0.06
250 0.06
251 0.07
252 0.06
253 0.06
254 0.07
255 0.06
256 0.06
257 0.06
258 0.06
259 0.06
260 0.07
261 0.08
262 0.1
263 0.12
264 0.19
265 0.23
266 0.31
267 0.33
268 0.37
269 0.43
270 0.46
271 0.49
272 0.46
273 0.43
274 0.35
275 0.35
276 0.31
277 0.24
278 0.19
279 0.14
280 0.09
281 0.08
282 0.07
283 0.04
284 0.03
285 0.03
286 0.03
287 0.03
288 0.03
289 0.03
290 0.03
291 0.04
292 0.06
293 0.11
294 0.16
295 0.17
296 0.17
297 0.23
298 0.24
299 0.28
300 0.32
301 0.32
302 0.27
303 0.27
304 0.27
305 0.22
306 0.21
307 0.18
308 0.13
309 0.13
310 0.17
311 0.26
312 0.28
313 0.32
314 0.35
315 0.37
316 0.41
317 0.44
318 0.45
319 0.37
320 0.34
321 0.31
322 0.29
323 0.26
324 0.22
325 0.15
326 0.09
327 0.08
328 0.08
329 0.07
330 0.06
331 0.06
332 0.07
333 0.09
334 0.09
335 0.11
336 0.13
337 0.12
338 0.12
339 0.13
340 0.13
341 0.12
342 0.12
343 0.12
344 0.11
345 0.12
346 0.12
347 0.12
348 0.12
349 0.14
350 0.15
351 0.2
352 0.21
353 0.24
354 0.29
355 0.34
356 0.43
357 0.45
358 0.46
359 0.41
360 0.47
361 0.45
362 0.41
363 0.36
364 0.31
365 0.27
366 0.25
367 0.23
368 0.17
369 0.16
370 0.14
371 0.14
372 0.1
373 0.12
374 0.12
375 0.12
376 0.12
377 0.14
378 0.13
379 0.12
380 0.14
381 0.14
382 0.16
383 0.18
384 0.21
385 0.27
386 0.31
387 0.36
388 0.42
389 0.45
390 0.44
391 0.45
392 0.48
393 0.44
394 0.42
395 0.37
396 0.31
397 0.32
398 0.32
399 0.29
400 0.21
401 0.21
402 0.23
403 0.23
404 0.22
405 0.15
406 0.13
407 0.13
408 0.13
409 0.1
410 0.07
411 0.06
412 0.08
413 0.09
414 0.09
415 0.12
416 0.12
417 0.12
418 0.12
419 0.14
420 0.16
421 0.23
422 0.33
423 0.4
424 0.45
425 0.49
426 0.54
427 0.57
428 0.59
429 0.57
430 0.52
431 0.51
432 0.51
433 0.49
434 0.44
435 0.4
436 0.33
437 0.28
438 0.26
439 0.22
440 0.2
441 0.21
442 0.22
443 0.23
444 0.23
445 0.24
446 0.21
447 0.17
448 0.13
449 0.11
450 0.1
451 0.09
452 0.08
453 0.07
454 0.07
455 0.07
456 0.07
457 0.08
458 0.08
459 0.1
460 0.18
461 0.24
462 0.25
463 0.26
464 0.3
465 0.36
466 0.39
467 0.45
468 0.46
469 0.5
470 0.53
471 0.54
472 0.51
473 0.43
474 0.41
475 0.34
476 0.27
477 0.23
478 0.23
479 0.28
480 0.28
481 0.3
482 0.31
483 0.33
484 0.34
485 0.31
486 0.31
487 0.25
488 0.29
489 0.27
490 0.27
491 0.25
492 0.22
493 0.2
494 0.18
495 0.16
496 0.13
497 0.14
498 0.14
499 0.16
500 0.21
501 0.21
502 0.25
503 0.33
504 0.38
505 0.43
506 0.45
507 0.47
508 0.48
509 0.54
510 0.49
511 0.41
512 0.38
513 0.37
514 0.36
515 0.34
516 0.32
517 0.3
518 0.36
519 0.39
520 0.36
521 0.31
522 0.28
523 0.3
524 0.29
525 0.27
526 0.2
527 0.17
528 0.17
529 0.17
530 0.17
531 0.17
532 0.16
533 0.17
534 0.25
535 0.27
536 0.31
537 0.35
538 0.35
539 0.36
540 0.36
541 0.34
542 0.29
543 0.28
544 0.27
545 0.25
546 0.28
547 0.25
548 0.31
549 0.31
550 0.28
551 0.29
552 0.28
553 0.31
554 0.36
555 0.39
556 0.36
557 0.4
558 0.49
559 0.58
560 0.66
561 0.73
562 0.75
563 0.82
564 0.85
565 0.91
566 0.91
567 0.9
568 0.9
569 0.9
570 0.9
571 0.9
572 0.88
573 0.88
574 0.86
575 0.86
576 0.86
577 0.86
578 0.83
579 0.77
580 0.77
581 0.75
582 0.76
583 0.74
584 0.69
585 0.66
586 0.59
587 0.61
588 0.55
589 0.48
590 0.38
591 0.31
592 0.28
593 0.22
594 0.2
595 0.13
596 0.11
597 0.11
598 0.1
599 0.08
600 0.07
601 0.06
602 0.05
603 0.05
604 0.05
605 0.07
606 0.08
607 0.09
608 0.09
609 0.09
610 0.11
611 0.11
612 0.12
613 0.11
614 0.09
615 0.1
616 0.1
617 0.09
618 0.07
619 0.08
620 0.11
621 0.17
622 0.26
623 0.31
624 0.38
625 0.48
626 0.56
627 0.64
628 0.71
629 0.74
630 0.76
631 0.8
632 0.83
633 0.77
634 0.73
635 0.65
636 0.58
637 0.5
638 0.39
639 0.28
640 0.2
641 0.16
642 0.14
643 0.15
644 0.16
645 0.14
646 0.15
647 0.18
648 0.17
649 0.19
650 0.23
651 0.24
652 0.3
653 0.38
654 0.4
655 0.42
656 0.42
657 0.4
658 0.39
659 0.37
660 0.29
661 0.23
662 0.21
663 0.17
664 0.2
665 0.22
666 0.22
667 0.21
668 0.21
669 0.19
670 0.18
671 0.19
672 0.2