Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2I6Y6

Protein Details
Accession A0A1Y2I6Y6    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
486-508TEHSPSARSRGRRRRASPPLIAAHydrophilic
NLS Segment(s)
PositionSequence
493-500RSRGRRRR
Subcellular Location(s) mito 11, plas 7, E.R. 4, nucl 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSRSFTATSNRHTQQSVGRGRVGHFAASPVGQRVSSQKLTAWLICLAFLAPSVLAAPPLEAGSSPRPPVQCQSFVFTWRGGTPPFTVSVLSGDTTETPLEQHGGISSGSFQWLADVPAGASVRLEVQDSSGASVDTGPLTIQAGSDSSCLPPSGQAQPQSSSPPDAPTSSPSAIPPTSAETSVDNPATSPSPQSPTGGASPSLPQQSPTTTAAAQGTTTPATGPGTATTANPSQTTPPTTASGPSKGSAPADASNSSVAPIGSPSQLSGSEAPSASRLLSSSTLEGTRADPTASGTLLPQPTLQVSPAPPLSIGVIIGAVVGIVIILIILILVILSWRRRRPIKAADQEMAAVQPPSRPASTKFVEAVELPKKYGVSIQGSSKLLRSMSVSRRSSTTLTVRTDSTGARASLGSLVDEVPIPGSDSEVSSKPLPSSSNTSVATGPETVPAAAPFVTATDVHSTIDVLSSGPPTHPFNDNNLKCTPTEHSPSARSRGRRRRASPPLIAADGGVRLAGGPPGEAVLIPDDRSESVPYLLPPPYSRYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.51
4 0.53
5 0.48
6 0.48
7 0.46
8 0.47
9 0.5
10 0.44
11 0.36
12 0.28
13 0.25
14 0.24
15 0.23
16 0.23
17 0.19
18 0.19
19 0.17
20 0.18
21 0.22
22 0.28
23 0.29
24 0.28
25 0.27
26 0.31
27 0.35
28 0.34
29 0.32
30 0.27
31 0.24
32 0.23
33 0.21
34 0.16
35 0.12
36 0.11
37 0.09
38 0.06
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.08
48 0.07
49 0.11
50 0.16
51 0.2
52 0.22
53 0.26
54 0.28
55 0.3
56 0.38
57 0.4
58 0.41
59 0.4
60 0.44
61 0.42
62 0.43
63 0.43
64 0.36
65 0.31
66 0.26
67 0.26
68 0.21
69 0.21
70 0.2
71 0.19
72 0.2
73 0.19
74 0.18
75 0.15
76 0.16
77 0.15
78 0.13
79 0.11
80 0.11
81 0.1
82 0.12
83 0.11
84 0.09
85 0.09
86 0.09
87 0.1
88 0.09
89 0.09
90 0.08
91 0.09
92 0.09
93 0.09
94 0.09
95 0.08
96 0.09
97 0.09
98 0.08
99 0.08
100 0.09
101 0.1
102 0.09
103 0.09
104 0.08
105 0.11
106 0.12
107 0.1
108 0.09
109 0.08
110 0.09
111 0.1
112 0.11
113 0.07
114 0.08
115 0.1
116 0.11
117 0.12
118 0.11
119 0.1
120 0.09
121 0.09
122 0.09
123 0.06
124 0.06
125 0.05
126 0.05
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.07
133 0.08
134 0.08
135 0.08
136 0.09
137 0.09
138 0.09
139 0.1
140 0.13
141 0.18
142 0.21
143 0.26
144 0.28
145 0.29
146 0.3
147 0.32
148 0.3
149 0.27
150 0.24
151 0.22
152 0.21
153 0.21
154 0.21
155 0.2
156 0.24
157 0.22
158 0.22
159 0.19
160 0.22
161 0.2
162 0.2
163 0.18
164 0.17
165 0.17
166 0.17
167 0.17
168 0.15
169 0.17
170 0.2
171 0.19
172 0.14
173 0.13
174 0.14
175 0.15
176 0.13
177 0.13
178 0.12
179 0.16
180 0.17
181 0.18
182 0.17
183 0.18
184 0.19
185 0.19
186 0.17
187 0.14
188 0.15
189 0.17
190 0.18
191 0.16
192 0.16
193 0.15
194 0.17
195 0.19
196 0.2
197 0.18
198 0.16
199 0.18
200 0.17
201 0.16
202 0.14
203 0.11
204 0.1
205 0.08
206 0.08
207 0.07
208 0.07
209 0.07
210 0.07
211 0.07
212 0.06
213 0.08
214 0.08
215 0.08
216 0.1
217 0.11
218 0.12
219 0.12
220 0.12
221 0.13
222 0.14
223 0.17
224 0.15
225 0.16
226 0.17
227 0.16
228 0.19
229 0.19
230 0.2
231 0.19
232 0.18
233 0.17
234 0.16
235 0.16
236 0.14
237 0.13
238 0.12
239 0.13
240 0.13
241 0.12
242 0.12
243 0.12
244 0.11
245 0.1
246 0.08
247 0.06
248 0.06
249 0.07
250 0.06
251 0.06
252 0.06
253 0.07
254 0.07
255 0.08
256 0.08
257 0.08
258 0.09
259 0.09
260 0.09
261 0.09
262 0.09
263 0.08
264 0.07
265 0.06
266 0.07
267 0.08
268 0.09
269 0.08
270 0.09
271 0.09
272 0.1
273 0.1
274 0.1
275 0.09
276 0.09
277 0.09
278 0.08
279 0.09
280 0.09
281 0.09
282 0.08
283 0.07
284 0.1
285 0.1
286 0.11
287 0.09
288 0.09
289 0.1
290 0.1
291 0.1
292 0.08
293 0.09
294 0.11
295 0.11
296 0.11
297 0.1
298 0.1
299 0.1
300 0.08
301 0.07
302 0.05
303 0.04
304 0.04
305 0.04
306 0.03
307 0.02
308 0.02
309 0.02
310 0.01
311 0.01
312 0.01
313 0.01
314 0.01
315 0.01
316 0.01
317 0.01
318 0.01
319 0.01
320 0.01
321 0.02
322 0.03
323 0.07
324 0.12
325 0.14
326 0.2
327 0.25
328 0.29
329 0.38
330 0.46
331 0.54
332 0.58
333 0.62
334 0.57
335 0.53
336 0.5
337 0.42
338 0.32
339 0.22
340 0.13
341 0.08
342 0.08
343 0.09
344 0.11
345 0.12
346 0.13
347 0.16
348 0.23
349 0.25
350 0.27
351 0.26
352 0.24
353 0.25
354 0.23
355 0.26
356 0.24
357 0.23
358 0.21
359 0.2
360 0.2
361 0.19
362 0.21
363 0.19
364 0.18
365 0.2
366 0.23
367 0.28
368 0.29
369 0.29
370 0.28
371 0.25
372 0.2
373 0.18
374 0.19
375 0.22
376 0.29
377 0.38
378 0.39
379 0.38
380 0.4
381 0.43
382 0.4
383 0.38
384 0.37
385 0.34
386 0.35
387 0.36
388 0.34
389 0.33
390 0.33
391 0.27
392 0.23
393 0.2
394 0.17
395 0.16
396 0.15
397 0.15
398 0.15
399 0.15
400 0.12
401 0.09
402 0.09
403 0.09
404 0.09
405 0.08
406 0.07
407 0.06
408 0.07
409 0.07
410 0.08
411 0.08
412 0.09
413 0.12
414 0.12
415 0.16
416 0.16
417 0.17
418 0.17
419 0.18
420 0.19
421 0.2
422 0.27
423 0.27
424 0.33
425 0.32
426 0.33
427 0.32
428 0.31
429 0.29
430 0.23
431 0.19
432 0.14
433 0.14
434 0.12
435 0.12
436 0.12
437 0.11
438 0.09
439 0.09
440 0.07
441 0.07
442 0.08
443 0.08
444 0.09
445 0.12
446 0.13
447 0.13
448 0.13
449 0.13
450 0.12
451 0.12
452 0.11
453 0.07
454 0.08
455 0.09
456 0.1
457 0.11
458 0.14
459 0.17
460 0.2
461 0.25
462 0.25
463 0.32
464 0.43
465 0.44
466 0.44
467 0.43
468 0.42
469 0.37
470 0.38
471 0.35
472 0.31
473 0.36
474 0.37
475 0.4
476 0.46
477 0.51
478 0.57
479 0.59
480 0.61
481 0.65
482 0.71
483 0.75
484 0.79
485 0.8
486 0.82
487 0.86
488 0.86
489 0.83
490 0.8
491 0.75
492 0.66
493 0.6
494 0.49
495 0.39
496 0.31
497 0.22
498 0.14
499 0.08
500 0.07
501 0.07
502 0.08
503 0.07
504 0.07
505 0.07
506 0.08
507 0.08
508 0.08
509 0.08
510 0.11
511 0.12
512 0.12
513 0.13
514 0.14
515 0.15
516 0.18
517 0.19
518 0.17
519 0.18
520 0.2
521 0.21
522 0.24
523 0.25
524 0.26
525 0.25