Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9P7V3

Protein Details
Accession G9P7V3    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
61-84INKAYRKKSRSLHPDKVKQRLRADHydrophilic
239-259APQPRNRKERRMQEKESRKDDBasic
401-420AKSSGSQGGKPIKRKSTKKRBasic
NLS Segment(s)
PositionSequence
66-96RKKSRSLHPDKVKQRLRADAQAAKKKSKKEG
242-290PRNRKERRMQEKESRKDDGKSSSKKSRKAASSKSSSRDASSAPAPAGAR
406-420SQGGKPIKRKSTKKR
Subcellular Location(s) cyto 8.5, extr 6, cyto_nucl 6, E.R. 4, mito 3, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MKLEYLVVGVLSLLTPLSAAWSKEDREIFRIRDEIAAHEADTGATFYEVLGVAASASLDDINKAYRKKSRSLHPDKVKQRLRADAQAAKKKSKKEGASDSAAASKGPSQAQVRKAIKEASERQARLSLIANILRGPARDRYDHFLANGFPLWKGTDYYYNRYRPGLGTVLVGVFIVGGGAIHYLALYMSWKRQREFVERYVTFARNTAWGSGGIPGIDAAPAPEPAPAAAEEDEAAAAAPQPRNRKERRMQEKESRKDDGKSSSKKSRKAASSKSSSRDASSAPAPAGARKRVVAENGKILVVDSQGDVFLEEEDEDGNVNEYLLDPNELLKPTFRDTAVVRVPAWIFQLTVGRYLSGSASAETDAAEDDSDIPQHTPPSSESAGEDFELLDKSTDSLSKAKSSGSQGGKPIKRKSTKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.09
5 0.11
6 0.12
7 0.17
8 0.22
9 0.24
10 0.3
11 0.36
12 0.34
13 0.38
14 0.44
15 0.42
16 0.42
17 0.42
18 0.37
19 0.36
20 0.34
21 0.31
22 0.29
23 0.27
24 0.22
25 0.2
26 0.19
27 0.15
28 0.14
29 0.11
30 0.07
31 0.07
32 0.06
33 0.05
34 0.07
35 0.07
36 0.07
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.04
43 0.04
44 0.04
45 0.05
46 0.05
47 0.06
48 0.11
49 0.16
50 0.19
51 0.24
52 0.31
53 0.36
54 0.44
55 0.51
56 0.57
57 0.63
58 0.72
59 0.77
60 0.8
61 0.85
62 0.85
63 0.88
64 0.85
65 0.82
66 0.77
67 0.75
68 0.7
69 0.68
70 0.66
71 0.63
72 0.64
73 0.65
74 0.64
75 0.64
76 0.63
77 0.62
78 0.64
79 0.65
80 0.62
81 0.61
82 0.67
83 0.64
84 0.65
85 0.61
86 0.53
87 0.47
88 0.41
89 0.32
90 0.23
91 0.19
92 0.16
93 0.15
94 0.19
95 0.21
96 0.27
97 0.32
98 0.42
99 0.43
100 0.41
101 0.43
102 0.42
103 0.4
104 0.42
105 0.44
106 0.43
107 0.48
108 0.46
109 0.45
110 0.46
111 0.43
112 0.36
113 0.32
114 0.25
115 0.21
116 0.22
117 0.2
118 0.16
119 0.17
120 0.16
121 0.14
122 0.15
123 0.17
124 0.19
125 0.21
126 0.24
127 0.29
128 0.33
129 0.33
130 0.31
131 0.27
132 0.25
133 0.23
134 0.22
135 0.16
136 0.12
137 0.12
138 0.12
139 0.11
140 0.11
141 0.12
142 0.19
143 0.22
144 0.29
145 0.35
146 0.38
147 0.39
148 0.38
149 0.38
150 0.3
151 0.3
152 0.25
153 0.18
154 0.15
155 0.14
156 0.13
157 0.12
158 0.11
159 0.07
160 0.04
161 0.03
162 0.03
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.02
169 0.02
170 0.02
171 0.02
172 0.02
173 0.04
174 0.05
175 0.1
176 0.16
177 0.18
178 0.19
179 0.24
180 0.29
181 0.35
182 0.41
183 0.42
184 0.46
185 0.44
186 0.47
187 0.46
188 0.42
189 0.35
190 0.29
191 0.24
192 0.17
193 0.17
194 0.14
195 0.11
196 0.1
197 0.1
198 0.1
199 0.1
200 0.07
201 0.07
202 0.06
203 0.05
204 0.05
205 0.04
206 0.04
207 0.04
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.06
214 0.06
215 0.07
216 0.07
217 0.07
218 0.07
219 0.07
220 0.06
221 0.05
222 0.05
223 0.03
224 0.04
225 0.07
226 0.09
227 0.12
228 0.19
229 0.24
230 0.33
231 0.37
232 0.46
233 0.52
234 0.61
235 0.69
236 0.71
237 0.74
238 0.77
239 0.83
240 0.82
241 0.78
242 0.72
243 0.64
244 0.57
245 0.53
246 0.52
247 0.5
248 0.49
249 0.51
250 0.56
251 0.6
252 0.64
253 0.66
254 0.66
255 0.65
256 0.67
257 0.7
258 0.68
259 0.71
260 0.7
261 0.69
262 0.66
263 0.58
264 0.5
265 0.42
266 0.34
267 0.28
268 0.24
269 0.21
270 0.16
271 0.18
272 0.16
273 0.19
274 0.23
275 0.22
276 0.22
277 0.21
278 0.25
279 0.24
280 0.3
281 0.32
282 0.3
283 0.33
284 0.33
285 0.32
286 0.28
287 0.26
288 0.21
289 0.15
290 0.13
291 0.07
292 0.07
293 0.07
294 0.07
295 0.07
296 0.06
297 0.06
298 0.05
299 0.05
300 0.05
301 0.05
302 0.05
303 0.05
304 0.05
305 0.07
306 0.06
307 0.06
308 0.05
309 0.06
310 0.07
311 0.08
312 0.09
313 0.07
314 0.09
315 0.12
316 0.13
317 0.13
318 0.15
319 0.17
320 0.2
321 0.23
322 0.22
323 0.22
324 0.23
325 0.31
326 0.33
327 0.32
328 0.28
329 0.28
330 0.29
331 0.27
332 0.28
333 0.19
334 0.15
335 0.14
336 0.19
337 0.17
338 0.19
339 0.18
340 0.16
341 0.16
342 0.16
343 0.15
344 0.12
345 0.12
346 0.1
347 0.1
348 0.11
349 0.11
350 0.1
351 0.1
352 0.08
353 0.08
354 0.07
355 0.07
356 0.08
357 0.08
358 0.09
359 0.1
360 0.1
361 0.12
362 0.14
363 0.14
364 0.15
365 0.16
366 0.22
367 0.22
368 0.22
369 0.22
370 0.22
371 0.23
372 0.21
373 0.2
374 0.14
375 0.14
376 0.14
377 0.13
378 0.11
379 0.09
380 0.1
381 0.12
382 0.13
383 0.15
384 0.19
385 0.22
386 0.26
387 0.26
388 0.28
389 0.31
390 0.36
391 0.42
392 0.43
393 0.45
394 0.49
395 0.58
396 0.63
397 0.67
398 0.69
399 0.71
400 0.74