Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2IKU4

Protein Details
Accession A0A1Y2IKU4    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-33TSSSGGKAAKKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
11-27GKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences KAAAPTSSSGGKAAKKKKWSKGKVKDKAQHAVVLDKATYDRIMKEVPTFRFISQSILIERLKVNGSLARVAIRHLEKEGQIKRIVHHSGQLIYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.55
3 0.64
4 0.71
5 0.78
6 0.82
7 0.85
8 0.87
9 0.9
10 0.9
11 0.91
12 0.88
13 0.84
14 0.81
15 0.71
16 0.63
17 0.53
18 0.46
19 0.37
20 0.3
21 0.23
22 0.16
23 0.15
24 0.12
25 0.12
26 0.09
27 0.08
28 0.09
29 0.1
30 0.1
31 0.14
32 0.19
33 0.19
34 0.22
35 0.23
36 0.21
37 0.23
38 0.23
39 0.22
40 0.18
41 0.19
42 0.16
43 0.18
44 0.18
45 0.16
46 0.16
47 0.15
48 0.14
49 0.13
50 0.13
51 0.12
52 0.13
53 0.13
54 0.14
55 0.14
56 0.13
57 0.14
58 0.19
59 0.18
60 0.18
61 0.19
62 0.22
63 0.23
64 0.32
65 0.36
66 0.34
67 0.37
68 0.38
69 0.38
70 0.43
71 0.45
72 0.37
73 0.38
74 0.37