Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2ILP3

Protein Details
Accession A0A1Y2ILP3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
40-59DARRGVPKRRDDDKHKPSKVBasic
NLS Segment(s)
PositionSequence
42-58RRGVPKRRDDDKHKPSK
Subcellular Location(s) extr 10, plas 7, mito 3, E.R. 3, pero 2, golg 2
Family & Domain DBs
Amino Acid Sequences MNSRFVLFFITLLAMALFVVATPVPNNDAALVKKALKQYDARRGVPKRRDDDKHKPSKVWRAAIPEPTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.04
5 0.03
6 0.03
7 0.03
8 0.03
9 0.04
10 0.05
11 0.06
12 0.06
13 0.07
14 0.07
15 0.09
16 0.1
17 0.12
18 0.13
19 0.13
20 0.16
21 0.18
22 0.18
23 0.18
24 0.24
25 0.28
26 0.37
27 0.42
28 0.42
29 0.48
30 0.54
31 0.61
32 0.63
33 0.65
34 0.62
35 0.65
36 0.7
37 0.71
38 0.76
39 0.77
40 0.8
41 0.76
42 0.75
43 0.74
44 0.76
45 0.76
46 0.71
47 0.65
48 0.62
49 0.64