Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2I5G9

Protein Details
Accession A0A1Y2I5G9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
67-90IPPPTRRRHPAPLRPSCRPRRAPFBasic
NLS Segment(s)
PositionSequence
63-81RAAAIPPPTRRRHPAPLRP
Subcellular Location(s) nucl 16, mito 4, cyto 2, plas 2, extr 2
Family & Domain DBs
Amino Acid Sequences MPYVPAMFSASLRDPSGPTAGLPLWFFQVAYVPNRKEFSDISSPPRLFSSARPPALHSARPLRAAAIPPPTRRRHPAPLRPSCRPRRAPFLATPPHLLSSEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.22
4 0.17
5 0.15
6 0.15
7 0.15
8 0.15
9 0.15
10 0.13
11 0.13
12 0.13
13 0.12
14 0.09
15 0.12
16 0.12
17 0.16
18 0.22
19 0.21
20 0.25
21 0.26
22 0.27
23 0.26
24 0.24
25 0.26
26 0.28
27 0.29
28 0.31
29 0.37
30 0.37
31 0.35
32 0.35
33 0.3
34 0.23
35 0.24
36 0.28
37 0.28
38 0.3
39 0.3
40 0.31
41 0.35
42 0.37
43 0.36
44 0.3
45 0.29
46 0.29
47 0.31
48 0.29
49 0.25
50 0.24
51 0.24
52 0.23
53 0.26
54 0.28
55 0.32
56 0.4
57 0.44
58 0.47
59 0.52
60 0.55
61 0.57
62 0.63
63 0.68
64 0.71
65 0.77
66 0.79
67 0.83
68 0.86
69 0.85
70 0.85
71 0.84
72 0.79
73 0.78
74 0.78
75 0.74
76 0.71
77 0.71
78 0.7
79 0.64
80 0.63
81 0.55
82 0.5